KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2019Help
Entry
Cp1002_2019       CDS       T01876                                 

Gene name
pspA1
Definition
(GenBank) Phage shock protein A
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2235650..2236537)
Genome map
AA seq 295 aa AA seqDB search
MANPFAKGWKYLTASLDQKIDENADPMVQIKQATDAAKEQHQKISEQAAAVIGNKNQLEM
KLNRLLADQKDLQQKARNAIQVSDNEADPVKKQESLNVAEIYATQLVSVEQQIEETKALH
TQAVSASEQATRQVKESEARLHEQLGQIDQLSSQVKQTKMQEASTKAMDQITALDPDRDV
PSLDQVREKIERRYADALGAQELMHNTMGDRIQEIDAAGADMRASAKLEEIRAQMRGQLN
GAEQPAKELNSGEPDAETPVVDEVPKDEASKASKEAASTSEKGEKESDKGEKSAE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacccattcgctaaaggttggaagtacttgactgcatccttggaccagaagatc
gatgaaaatgccgatccgatggtgcaaattaagcaggccactgatgctgctaaagaacag
catcagaagattagtgagcaagctgccgctgtaattggcaataaaaaccagctggaaatg
aagctcaatcgcctgcttgcagaccagaaggatctgcagcaaaaagctcgcaatgctatc
caggtgagcgataatgaggccgatccggtaaaaaagcaagaatcgctcaatgttgcggag
atctatgcgactcagctggtgagcgttgagcagcagatagaggaaaccaaagctctacac
acccaggcggtgtctgcttctgagcaggcgactaggcaggtcaaggagtctgaggcacgc
ctccacgagcagcttggacagatcgatcaattgtctagccaggtgaagcaaaccaagatg
caagaggcctcgaccaaggcgatggaccagatcacggcgctcgatccggatcgcgatgtg
ccatccttggatcaggttcgtgaaaagatcgagcgacgttacgctgacgctcttggcgct
caagaacttatgcacaacaccatgggagaccggatccaggaaattgatgcggcaggggca
gatatgcgtgcttctgccaagttagaggagatccgggctcaaatgcgtggacagctaaac
ggtgcggaacaaccggcgaaagagctgaactctggagaaccggacgcggaaacaccagtg
gtggacgaggttcctaaggatgaagcctctaaggcttccaaagaagccgcttcgactagt
gaaaaaggcgaaaaagaaagcgacaaaggggaaaaatccgctgagtaa

DBGET integrated database retrieval system