KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2020Help
Entry
Cp1002_2020       CDS       T01876                                 

Gene name
trxA1
Definition
(GenBank) Thioredoxin TrxA
  KO
K03671  
thioredoxin 1
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
Chaperones and folding catalysts [BR:cpk03110]
 Protein folding catalysts
  Protein disulfide isomerase
   Cp1002_2020 (trxA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2237123..2237491)
Genome map
AA seq 122 aa AA seqDB search
MATIDVTEDTFEQTVTTDGIVIVDAWASWCGPCRAFAPTFEKASENHTDVVFAKLDTEAN
QGLSAALQIQSIPTLMIFREGILVYREAGALPAAALEDLIGQVKGLDMEDVKRQVAEQNN
NN
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgattgatgtaacggaagacacatttgagcagacagtcaccacggacgggatt
gtcatcgtcgatgcatgggcatcgtggtgtggtccttgtcgagcatttgcgccgacgttt
gagaaggcttccgagaaccacactgatgttgtctttgccaagctcgacacagaggcaaat
cagggactctcggctgctttgcagatccagtctattcctacgctcatgattttccgcgag
ggtatcttggtgtaccgagaagccggtgcgcttccggcggctgccttggaagatctgatt
gggcaggtgaaggggcttgatatggaagacgtgaagcgtcaggtcgctgaacagaataat
aataattag

DBGET integrated database retrieval system