KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2021Help
Entry
Cp1002_2021       CDS       T01876                                 

Definition
(GenBank) Cation transport protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2237685..2237888
Genome map
AA seq 67 aa AA seqDB search
MTKNYFVEGMTCAHCVASVTEEVNEIPGTQGVEVDLETGRLTVTGEDFTDADVAAAVKEA
GFSIKEQ
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaactattttgttgaaggcatgacctgcgcacattgtgttgcttccgtcacc
gaggaggtcaacgagatcccaggaacccagggtgttgaggttgaccttgagaccggccgc
cttaccgttaccggtgaagattttaccgacgccgatgtggccgcagcagtcaaagaagcc
ggattttccatcaaagaacagtaa

DBGET integrated database retrieval system