KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2027Help
Entry
Cp1002_2027       CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
2245615..2245797
Genome map
AA seq 60 aa AA seqDB search
MTRRKNHCSVIHKRCGQVVYNFHLTLKDFRKIAVQGMFLSLLMFYITKINPVYNSPNLHV
NT seq 183 nt NT seq  +upstreamnt  +downstreamnt
gtgactagaagaaagaatcactgctcagttatccacaagcgctgtggacaggttgtgtat
aactttcacctcacactaaaagattttagaaaaatagcagttcaaggcatgtttttatcc
ctgttaatgttttacataacaaaaataaatccggtgtataactcccctaacctgcatgtt
tga

DBGET integrated database retrieval system