KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2028Help
Entry
Cp1002_2028       CDS       T01876                                 

Gene name
rplI
Definition
(GenBank) 50S ribosomal protein L9
  KO
K02939  
large subunit ribosomal protein L9
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Cp1002_2028 (rplI)
Ribosome [BR:cpk03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Cp1002_2028 (rplI)
  Bacteria
    Cp1002_2028 (rplI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2246101..2246553)
Genome map
AA seq 150 aa AA seqDB search
MKLILTAAVENLGVPGDIVEVKDGYGRNLLLPRGLAIVATRGAEKQIEGIKRAQEARAIR
DLDHAREVKAQLEALEGVTVAVKTSEKGKLFGSVSAEDIAAAVKKAGGPNLDKRSIELPK
RLVKSIGTFSVNVKLHSDIAATVNFEVVAA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgatcctcaccgctgccgttgaaaacctcggtgtccctggtgacatcgttgag
gttaaggacggctacggacgtaaccttctgcttcctcgcggcctggctatcgtagccacc
cgcggcgcagagaagcagattgagggcatcaagcgtgcccaggaagctcgcgctattcgc
gatctggaccatgcacgtgaggtcaaagcacagctcgaggcacttgagggtgtcaccgtg
gcagtgaagacctctgagaagggtaagctcttcggctccgtttccgccgaggatattgcc
gctgccgttaaaaaggctggcggtccgaacctggacaagcgttccattgaattgccgaag
cgactggttaagtccatcggtacgttctctgtgaacgttaagctgcactccgacatcgca
gcaacggttaacttcgaggtcgtcgccgcctaa

DBGET integrated database retrieval system