KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2030aHelp
Entry
Cp1002_2030a      CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2247645..2247893
Genome map
AA seq 82 aa AA seqDB search
MTHGPHHLLWSCIFKFGHTPVGCSRRVVASATVQRYPTDYQKSILFSSFVAEAIAKGKRE
QKIIARHNEPVVSKHFQCLNQP
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcacggacctcatcacctcctatggtcttgtatttttaagttcggccacaccccg
gttggatgtagcaggagggtcgttgcgtcagcaaccgttcaaagataccccaccgactac
caaaagtcgattcttttcagcagttttgtggccgaggccatcgctaaagggaaacgtgaa
cagaaaataattgctaggcacaacgagcctgtagttagcaaacactttcagtgcttaaac
caaccttga

DBGET integrated database retrieval system