KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2046Help
Entry
Cp1002_2046       CDS       T01876                                 

Definition
(GenBank) Glycopeptide antibiotics resistance protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VanZ
Motif
Other DBs
NCBI-ProteinID: ADL21902
Position
complement(2260612..2261133)
Genome map
AA seq 173 aa AA seqDB search
MVLQRMGSVKAASATLVAALAVVFALTLMKGPYSFGGLWSTEAHRNRSIDLQLFDAWNNP
TLWYAPWLDAVGNVALFIPFGFLLVTILAGHWKAPIIFSTMLGFLMSVGIEATQYVYAIG
YTDLDDVLCNTVGAFMGACFARILGSRGRGLVVTFFLVGALCILAEMILSIVF
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggttttgcaacgaatgggttctgtgaaggcggcgtcggcgacgcttgtggcggcgctg
gctgtggtatttgcgctgactttgatgaagggaccctattcatttggcggtttgtggagc
accgaggcccacagaaaccgttctattgatctgcagcttttcgacgcctggaacaacccc
acgctttggtatgcgccctggttggatgctgtgggaaacgtggcactctttatccccttt
ggttttcttctggtgacaatactcgctggtcattggaaggcccccataattttttccaca
atgcttggcttcctcatgagcgtggggatagaagccacccagtatgtctatgccattgga
tacacggacttagatgatgttttatgcaacacggtaggtgccttcatgggggcatgcttt
gcccgaatcctagggtcccgcggacgcggccttgtggtcacattcttcttggtgggtgct
ctgtgcatccttgcagagatgatactttctatcgtcttttag

DBGET integrated database retrieval system