KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2048Help
Entry
Cp1002_2048       CDS       T01876                                 

Gene name
leuS
Definition
(GenBank) Leucyl-tRNA synthetase
  KO
K01869  
leucyl-tRNA synthetase [EC:6.1.1.4]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cp1002_2048 (leuS)
Enzymes [BR:cpk01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.4  leucine---tRNA ligase
     Cp1002_2048 (leuS)
Amino acid related enzymes [BR:cpk01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Cp1002_2048 (leuS)
Transfer RNA biogenesis [BR:cpk03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cp1002_2048 (leuS)
 Prokaryotic Type
    Cp1002_2048 (leuS)
Mitochondrial biogenesis [BR:cpk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cp1002_2048 (leuS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2264393..2267254)
Genome map
AA seq 953 aa AA seqDB search
MTNPSESTTGPAFRYTAQLAGDIERTWQQFWIDNGTFNAPNPVGDLAVAGQELPEDKLFV
QDMFPYPSGAGLHVGHPLGYIATDVFARFNRMLGKNVLHTLGYDAFGLPAEQYAIQTGTH
PRATTMSNIANMQRQLSALGLGHDPRRSVATTDPEFYKWTQWIFLQIFNAWFDTQQQKAR
PISELIPLLESGEVALPEGFEGSANSYSELDAVEKAKVIDEFRLVYRSHSMVNWCPGLGT
VLANEEVTADGRSERGNFPVFRKNLSQWMMRITAYSDRLIDDLDALDWPDKVKSMQRNWI
GRSRGAEVDFDVLGHTITVFTTRPDTLFGASYMVLAPEHELVDALVAAGTNSYDGVDPRW
TFEQSCPADAVKAYRASIAAKSDLERQENKEKTGVYLGVNAVNPVNGESIPVFIGDYVLT
GYGTGAIMAVPAHDTRDYEFATEFGLPIREVVAGGNVAEEAYTESGVAVNSANDEGLDIN
GLDKQEAIARVIEWLVDKQKGSEKIQYKLRDWLFARQRYWGEPFPVVYDADGVAHALPES
MLPVELPEVEDYKPVSFDPDDADSEPQPPLAKATEWTQVELDLGDGLKTYTRDTNVMPQW
AGSSWYQLRYIDPTNNKQFCDIENERYWTGPRGENDLGGVDLYVGGVEHAVLHLLYSRFW
HKVLFDLGYVTSGEPYRRLFNQGYIQAFAYTDSRGVYVPAAEVEEKDGKFFYQGEEVNQE
YGKMGKSLKNAVAPDEICSDFGADTLRVYEMAMGPLDTSRPWATKDVIGAHRFLQRLWRL
VVSEDDGSVVVTDAGLADDDLKQLHRTIAGMRDDYEGLRINTVVAKAIEYVNYLTKNYAK
GAPRAAVEPLVIMVAPVAPHIAEELWKRLGHEETITFVAFPDYDEKWLVDDEVEMPIQIN
GKVRARIMVPADATQDQIVEIALAEPTVQSHLEGKNLFKQIVVPGRMVNLVIK
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atgactaatccgagcgagagcactactggtcctgcgtttcggtataccgcgcagctggcc
ggggatattgagcgtacgtggcagcaattctggatcgacaatggcacttttaatgcgcct
aacccagtgggtgacctagctgtcgctggacaagagcttccagaggacaagctcttcgtt
caagatatgttcccctacccttccggtgctggtctgcatgtgggccaccccttggggtat
atcgcgacggacgtttttgcgcgttttaaccgcatgctgggtaagaatgtgctgcatacc
ttgggctatgacgcctttggtttgccggcggagcagtatgcaattcagacgggtacgcat
ccgcgtgcgaccaccatgtccaatattgcgaatatgcagcgccagctgagtgcgttgggt
ttggggcatgatcctcgccgtagtgtggctaccactgaccctgagttttataagtggacg
cagtggattttcttgcagattttcaatgcctggtttgatacccagcagcaaaaggcccgc
cctatttctgagttgattccacttctggagtctggcgaggtggcattgccggagggcttt
gaaggttctgctaactcttattcggagttggatgcggtagaaaaggccaaggtcattgat
gagttccgcttggtttaccgttctcattcgatggtgaattggtgccctgggttgggtacg
gttctggctaatgaggaggtcaccgctgatggacgatcggagcgcgggaatttccctgtg
ttccgcaagaacctttcgcagtggatgatgcgtatcactgcgtattcggatcgccttatt
gatgaccttgatgcgctagattggccggacaaagtcaagagcatgcagcgtaactggatc
ggtcgttcacgtggtgccgaggtggattttgatgtccttgggcacacgatcacagtgttt
accactcgcccagacacgttgttcggtgcgtcgtatatggttcttgcgcctgagcatgag
cttgtcgacgccctggtggccgccggtacgaactcctacgacggggtcgatcctcgctgg
acctttgaacagtcctgccctgccgatgccgtaaaggcataccgcgcttctattgcagct
aagagtgatcttgagcgccaggagaacaaggaaaagacgggtgtgtacctcggtgtaaat
gccgtgaatcccgtcaacggtgagagcattccggtatttatcggcgactatgttctaacg
ggttatggcacgggtgcgatcatggctgttcctgcgcacgatacacgtgactatgagttt
gccaccgagtttggcctgcctatccgtgaagtcgttgctggtggcaatgttgcggaagag
gcttacacggaatcgggcgtagccgtgaactccgctaacgatgaaggcttagatattaat
ggcctggacaagcaggaagcgattgctcgggttattgaatggctcgtggacaagcaaaaa
ggctctgagaagatccaatacaagctgcgagattggctgtttgcgcgtcagcgttattgg
ggcgagccgttccccgtagtctacgacgcagatggcgttgctcatgcgcttcctgagtct
atgctgccggtggaactgcccgaggttgaagactataagcctgtctcttttgatccggac
gatgccgattctgagccgcagccaccgttggctaaggccacggaatggacccaggtggag
ctcgacctgggcgatggcctaaagacttacacccgcgacactaacgttatgccacagtgg
gcaggttcctcgtggtatcagctgcgttatatcgatcccaccaataacaagcagttctgc
gatatagagaatgaacgctattggacagggccacgcggggagaatgacctcggcggcgtg
gacctgtacgtgggaggcgtggagcacgctgttctgcacttgctctactcacgcttctgg
cacaaggtgctttttgatcttggctatgttacttctggtgagccttatcgtcgcctgttt
aaccagggatatattcaggcctttgcttataccgatagtcgcggagtgtatgttcctgct
gctgaggtggaagagaaggacggcaagttcttctaccaaggcgaagaggtgaatcaggaa
tacggcaagatgggtaagtccttgaagaatgccgtggctccggatgagatctgctctgat
tttggtgccgatactctccgcgtctatgagatggcgatggggcctttggatacgtctcgc
ccgtgggcaaccaaagatgttattggtgcgcatcgcttcctgcaacgattgtggcgcctt
gttgtttctgaagacgacggctccgttgtggtcacggatgcgggacttgccgacgacgac
ctcaagcaactgcaccgtactattgcgggcatgcgtgatgactatgagggcctgcgcatt
aataccgtcgttgctaaggccatcgagtacgtcaactacttgaccaagaactatgccaag
ggtgcgcctcgcgccgccgtagaaccgctggtgatcatggttgcccccgttgccccacac
atcgcggaagaactatggaagcgtctcggccacgaggagactatcacattcgttgctttc
ccggattatgacgagaaatggctcgttgatgatgaagtagaaatgcctattcagatcaac
ggtaaggtgcgcgctcgcattatggtgcctgccgacgctacacaggatcagatcgtagag
attgcgctcgcagaacctacggtgcaaagtcaccttgaaggtaagaacctgttcaagcag
attgttgtgccggggcgcatggttaaccttgtgattaagtag

DBGET integrated database retrieval system