KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2053Help
Entry
Cp1002_2053       CDS       T01876                                 

Definition
(GenBank) ABC transporter inner membrane protein
  KO
K02004  
putative ABC transport system permease protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Module
Putative ABC transport system
Brite
Transporters [BR:cpk02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    Cp1002_2053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2269207..2270259)
Genome map
AA seq 350 aa AA seqDB search
MFLGLRDIRSAGGRFALIASVVGLITLLIVMLTGLTQGLGARNTAALEYLAKDGAKFVFT
APTGEASFSSSEISQEILDKWKDAAGAENVTPVGVNQTRIESNDRADSAAVMGLPVGTSV
EGSSETIGEGALVPKSIADKIEVAAGDTLNIGGVAVKVDGVVEDTYYSHSSVVWVNSEVW
KKESHSPGIATLLLVRGDAQPQDMKNEQVTDLKGAFDALASYKSEQSSLKNMQGFLYAIS
ALVTISFLTVWTLQRTRDIAVLTALGASKGYLLKDAIGQAAIVLAMGVIAGAGIGALLGW
IVSQAVPFEVSVLSVLGPAAAIWLLGLVGSFVAVRNVTKVDPHIALGAAA
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcggtttacgtgatattcgttcagcgggcggtcgcttcgctttgattgcctct
gtggtgggcttgatcactcttttgatcgtgatgcttactggtttgacgcaggggctgggc
gcgcggaataccgcggcgctggaatacttggccaaagatggtgccaaatttgtttttacc
gcccctacaggcgaggcctcatttagttcttcggagataagccaggagatcctggataag
tggaaagacgctgctggcgcggagaatgtgactccagtaggtgtgaaccagacgcgaatt
gaatcaaatgatagagccgattctgcagctgtgatggggcttcccgtggggacctcggta
gaaggctcgtctgaaacgataggtgaaggtgctcttgtacctaagtccattgcagacaag
attgaggtcgcggcgggagacaccctcaatatcggtggcgttgccgtaaaagtggacggt
gtagtggaagatacgtactacagccactcctctgtggtttgggtgaattctgaggtctgg
aagaaagaaagccacagccccggaattgctacgctgctcctcgtacgcggtgatgctcag
ccgcaggacatgaagaatgagcaggtcactgacctcaagggagcatttgatgctctggct
tcttataagtctgagcagtcctcgcttaagaatatgcagggattcctctacgcaatttct
gctttggttactatttccttcctcaccgtatggacgctgcagcgcacccgcgatattgca
gttttgactgccttgggtgcgtccaagggatacctacttaaggatgcgatcggtcaagcg
gcaatcgttcttgcgatgggtgttatcgctggcgctggtatcggagcgctcctggggtgg
attgtttctcaggccgtaccgtttgaggtgtctgtgttgagtgttcttggtccggcagca
gcaatttggctgcttggtttagtgggatcgtttgtggcggtccgaaatgttactaaggtt
gatccgcatattgcgctaggagctgcagcatga

DBGET integrated database retrieval system