KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2062Help
Entry
Cp1002_2062       CDS       T01876                                 

Gene name
nanK
Definition
N-acetylglucosamine kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cp1002_2062 (nanK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cp1002_2062 (nanK)
   00052 Galactose metabolism
    Cp1002_2062 (nanK)
   00500 Starch and sucrose metabolism
    Cp1002_2062 (nanK)
   00520 Amino sugar and nucleotide sugar metabolism
    Cp1002_2062 (nanK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cp1002_2062 (nanK)
   00524 Butirosin and neomycin biosynthesis
    Cp1002_2062 (nanK)
Enzymes [BR:cpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cp1002_2062 (nanK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2281643..2282557)
Genome map
AA seq 304 aa AA seqDB search
MIGAGNKVQTPVRIGVDIGGTKIAAGLVADANPTTVIEYRRRPTPASNVIQEVAGVIQEL
IDVSPTAVSSIGIGAPGVIDPIEGNVVSSGPTMQGWAGTKIADTLREQFPVPVAVHNDVR
VMGLGESIYGAGQDFNNILFVSLGTGVGGALVRDGGLVASPHCTAGELRCLWGRLPDGSA
ALLESFASGPGLADSYNAYAEHPAVDLHEIMARYHAGEEYARGVIEEHLFACGVAIGGFI
SAIDVDAVVVGGGVGNIGDAIINPFARGLKEGAIPPLDAVPVIQAQLGTDAPIVGAAYLG
KTQD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgattggcgcaggcaataaagtgcaaacccccgtacgcattggcgtggatattggtgga
accaagatcgcggcgggcctggtggcggatgctaaccccaccaccgttattgagtatcgt
cgtcggcctacgcccgcgagcaatgtgatacaagaggtcgctggcgttatccaagagctt
atagacgtctcccctaccgcggtttcgagcataggaatcggtgctccaggggtcattgat
cccatagaaggcaacgtagtgtcctcggggccgaccatgcagggatgggcgggaactaag
atcgcggatacgctgagggaacaattcccggttcccgttgccgtgcataacgacgtccgc
gttatggggctgggcgagtccatctatggcgctggtcaggactttaacaatattcttttt
gtcagcctgggcactggcgtgggcggggcacttgtgcgtgatggtgggcttgttgcctcg
cctcactgtaccgctggagagctgcgttgcctgtggggacggctccccgatggatccgct
gccctcttagagtccttcgcctctggtcctggactcgctgactcctataacgcgtatgcg
gagcacccagccgtggatctccacgagattatggctcgataccacgcgggtgaagaatat
gcgcggggtgttattgaggaacatctctttgcgtgcggggttgctatcggcgggtttatt
agtgccattgacgtggatgctgtggtggtcggcggtggcgtgggcaatattggcgatgcc
attattaacccctttgctcgtgggctaaaagaaggcgccatccctccactcgatgcagta
ccagttatccaggcacagctaggaaccgatgctcccatcgtaggagccgcatatctgggg
aagacccaagactaa

DBGET integrated database retrieval system