KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2065Help
Entry
Cp1002_2065       CDS       T01876                                 

Gene name
oppB6
Definition
(GenBank) Oligopeptide transport system permease protein oppB
  KO
K02033  
peptide/nickel transport system permease protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cp1002_2065 (oppB6)
Transporters [BR:cpk02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Cp1002_2065 (oppB6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2285729..2286694
Genome map
AA seq 321 aa AA seqDB search
MSNLLRLIGRRLIALPIMILGVTFLVFFIMSFSPADPARLALGETASLEALEEYRETHGL
NDPLLMRYYHFLVDMLHGDLGTTTGSASVTDVVAKAFPITLQLTFLGLILAAVFSLVFGV
IAALYRDKWPDQLIRVVSIAALATPSFWLAILLIQWLGTIPGAWGLFPALITSWVKFTED
PGVYLNNLFLPAVALAVPVAGSLTRVVRTAMVEELDKDYVRTAIGSGIPKAEVISRNVLR
NALITPITVLGLRVGYLMGGAVIIEIIFNIQAMGQLILDGVTRNDVYLVQGVTLTVAITF
IIINIIVDMLYVLVNPRIRSI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatctgctacgactgatcggtcggcgcctgattgcgctacccatcatgattctt
ggcgtgaccttcttggtgttcttcatcatgtccttcagccctgccgatcctgctcgcctc
gcgctaggggagacggcctcgctggaggcgctcgaagaataccgtgagacccacggcctc
aacgaccctctgttgatgcggtattaccacttcctcgtggacatgctccacggcgatctt
ggtaccacaactggtagcgcctctgtcacagacgttgttgctaaggcattcccgattacg
ctgcagctcaccttcttaggattgatcctcgctgcggtattctccctcgtctttggcgtc
atcgcggccctctaccgagacaaatggcctgaccaattgatccgcgtcgtctctattgcg
gcactggccaccccttctttctggttggctatcctgctcattcagtggctgggaacaatc
cccggcgcgtgggggctgttccccgcattgattacctcgtgggtgaagttcaccgaagac
cctggggtttatctcaacaaccttttcctcccggctgtggccttggccgttccagttgcc
ggttcactcacccgcgtagtacgtaccgccatggtggaagagctggacaaggattacgtg
cgtactgccattggatccggtattcccaaggctgaagtcatctcccgtaacgttctccgt
aacgcgcttattacccccatcacggttctggggctccgcgttggttacctcatgggtggc
gctgtgatcatcgagatcatcttcaacattcaggctatgggtcagctcatcctcgacggt
gttacccgcaacgatgtttacctcgttcagggcgttaccctcactgtcgctatcacgttc
atcatcatcaacatcatcgttgacatgctttatgtgctcgtcaacccacgcatcaggagc
atctaa

DBGET integrated database retrieval system