KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2066Help
Entry
Cp1002_2066       CDS       T01876                                 

Gene name
oppCD2
Definition
(GenBank) Oligopeptide transport ATP-binding protein OppD
  KO
K02031  
peptide/nickel transport system ATP-binding protein
K02034  
peptide/nickel transport system permease protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Quorum sensing
Module
Peptides/nickel transport system
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cp1002_2066 (oppCD2)
Transporters [BR:cpk02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Peptides/nickel transporter [MD:M00239]
    Cp1002_2066 (oppCD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2286694..2288727
Genome map
AA seq 677 aa AA seqDB search
MRRNLTEKLENRAGQRFSGIRSLPIASKVALTFLTLVALMAIFAPLITAYDPLASSTPVQ
PPSGDHWFGTDAIGRDIFARVAYGARASLIIGLCATGAALVAAAVIGSIAATAGKVVSEV
LMRILDIIMSFPGIALAAVFVAVFGTSIPVLVFAIGFLYVPQLSRIVRANVLSEFGEDYV
SAAKVMGAQIPHILIKHVARNTIAPIAVFATVLVADAIVFEASLSFINAGVKPPSPSWGN
ILADGKQLLLTGSWWPTFFPGLMILVTVLALNILSEGLTDAMASPRIKLTAKVSDNDPSI
DTRNTLGQSTEKEAALSLNTSLAALRDAEMSENRRLVYTRGESPLIEVKDLSIAFPAAHG
DVNIVDKVNFTVSPGQTMGLVGESGCGKSLVSMAIMGLLPPTAKITGEILFDGKNLLDLK
PEEHNALRGHDMAMIYQDALSSLNPSMLIRTQMQQLIRRGGKRAAEELMELVGLDPVRTL
KSYPHELSGGQRQRVLIAMALTRNPRLLIADEPTTALDVTVQHQVVDLLNDLREKLGFSM
VFVSHDLALVAKLAHKITVMYAGQVVEQGNTRELLSNPQHEYTRGLLGAVLSIEAGADRL
YQVPGTVPSPREFVIGDRFAPRSSHPTTGLDQRPLLRLVDGSETHCFAATDALLALRREE
AAASSNLDIEGLEGEIR
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgcaacctgactgaaaaactcgaaaaccgcgcagggcaacgattctctggaatt
cgttctttgcccattgcctccaaagtagccctgacattcctcacgttggtcgccctcatg
gctatctttgcgccactcattactgcttatgatccgttggcgtcctctacaccagttcag
ccgccgagcggagaccactggtttggtaccgatgccatcggccgcgatatctttgcccgc
gtggcttatggcgcccgcgcatcactgatcataggtctctgtgccactggcgcagcgctg
gtggccgccgcagttattggttctatagcagcaactgcaggcaaggtcgtctctgaagtc
ctcatgcgcatcctggacattattatgtccttccccggcatcgctcttgcagctgtgttt
gttgccgtctttggcacttccatcccggtgttggtctttgctatcggtttcctctatgtt
ccgcagctctctcgcatcgtgcgagctaatgtgctcagtgaattcggcgaggactatgtc
tctgcggccaaggttatgggcgcccagatcccacacattctgatcaaacacgttgctcgt
aacaccatcgccccgattgcagtctttgccactgtgctggttgcagatgccatcgtattc
gaggcctctctatcttttattaacgccggtgtgaagccgccttcaccctcatggggaaat
atcctcgccgacggtaagcagctactccttacaggttcttggtggcccacattcttccct
ggcctaatgattcttgtaaccgtgctcgcgttaaacatcctctccgaggggcttaccgat
gctatggcctccccacgcatcaaactcacggccaaggtatccgataatgaccccagcatc
gatactcgcaatactcttggacagtccactgagaaggaagcagccctctcgctcaacacc
tcactcgcggctctcagagatgcagagatgagtgaaaatcgccgtcttgtttatacgcgt
ggtgagtccccgctcatcgaggtcaaggatctatccattgccttccccgcagcacacggt
gatgtaaatatcgtggataaggtgaacttcaccgtgtccccaggacagacgatgggtctg
gtgggcgagtcgggatgtggtaagtctctggtttctatggccatcatgggcctgcttcct
cccaccgccaagatcactggtgaaatcctctttgatggcaagaatctcctagatctcaag
ccagaagagcacaatgccctacgcggacatgatatggccatgatctaccaagatgctctg
agctctttgaatccctccatgttgattcgcactcaaatgcagcagctcattcgccgcggc
ggaaagcgcgctgcagaagagctgatggagctcgtcggacttgatccagttcgtactctc
aagtcttatccgcatgagctttccggcggtcagcgccaacgcgttctcatcgctatggcg
ctcacgcgtaacccacgcctactcatcgcggacgagccaacaacagccctcgacgtgact
gtgcagcatcaagttgttgatttgctcaatgatctgcgtgaaaagctcggcttctccatg
gtctttgtcagccacgatctcgctttggtggccaagctggctcacaaaatcacggttatg
tacgcaggtcaggtcgttgagcagggcaacacccgcgagcttctctccaacccccaacac
gagtacacccgagggcttctgggcgcggtgctatccatcgaagctggcgcggatcgtctc
tatcaggtaccgggaaccgtgccgagccctcgcgagtttgtgatcggcgaccgctttgca
ccacgttctagccacccgaccacgggattggatcaacgtccgttgctccggcttgttgac
ggttcagagacccactgctttgccgccacagatgcgctgctcgcgttgcgtcgcgaggaa
gcagccgccagcagcaacctcgatattgaaggtttagaaggtgaaatccgatga

DBGET integrated database retrieval system