KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2068Help
Entry
Cp1002_2068       CDS       T01876                                 

Gene name
nanL
Definition
(GenBank) Dihydrodipicolinate synthase
  KO
K01714  
4-hydroxy-tetrahydrodipicolinate synthase [EC:4.3.3.7]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Monobactam biosynthesis
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cp1002_2068 (nanL)
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Cp1002_2068 (nanL)
Enzymes [BR:cpk01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.3  Amine-lyases
    4.3.3.7  4-hydroxy-tetrahydrodipicolinate synthase
     Cp1002_2068 (nanL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2289584..2290507
Genome map
AA seq 307 aa AA seqDB search
MSSIVSGIVPPVLTPLHADRSLDLESLARLVEHLIDAGVDGLFALGSSGEVAFLSDEDRG
IVIREIVKLAKGRVPVYAGVIDTQANRVIEHVRQAEAAGVDAVVVTAPFYAICGPNEIEA
HFRTIAEATDLPIIAYDIPVCVYSKLPSEMLVKLGKDGVLAGVKDSSGDDVSFRRLVMLN
KTAGSPLTLLTGHEAVVDGSFIAGADGCVPGLGNVDPAGYVRMWKAAQSGEWETVRKEQD
RLAALFEIVFQPRGKVGPAAGVGSFKTALELMGVFSSNLMSAPLAPIDDAESREDIAAIL
RTAGLLD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccatcgtttccggcatcgtccccccagttcttacgcccctacatgcagaccgc
agccttgatcttgaatcactagctcgcctcgttgaacacctcatcgatgctggtgttgac
ggtttgtttgccctaggttcttccggagaagtcgctttcctcagcgatgaggatcgcggc
attgtgatcagggaaattgtgaagctagccaaaggccgcgttcctgtgtacgccggggta
attgacacccaggctaatcgcgtgatcgaacatgtccgtcaggcagaggcagctggcgta
gacgccgtagtggtcacggcacccttctatgccatctgtggccccaacgagatcgaagca
catttccgcactatcgcagaggccaccgacctccccattattgcttatgacatccccgtg
tgcgtgtactccaagctgccctcagaaatgctggtcaaacttggcaaggacggcgtcttg
gcgggcgtgaaggattcctccggtgatgatgtttccttccgccgcttggtcatgctcaac
aagacggctggctcgccgttgaccctgctgactggccacgaggcagttgtagacgggtcc
ttcatcgcaggtgccgacggctgtgtccccggtctgggcaacgtcgatcctgcgggatat
gttcgcatgtggaaggcagcccagtccggcgagtgggagaccgtgcgcaaagagcaggat
cgtctcgccgcactctttgaaatcgtcttccagccccgtggcaaggtcgggccggctgcc
ggcgttggatcgttcaagactgccctggaactcatgggcgtgttctcttcaaacttgatg
tctgcaccactcgcgcctatcgacgacgccgagtctcgtgaagacatcgcagcaatccta
cgcaccgcaggtttgctggactga

DBGET integrated database retrieval system