KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2069Help
Entry
Cp1002_2069       CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
Position
complement(2290621..2291040)
Genome map
AA seq 139 aa AA seqDB search
MRKLTAIAPAALALGIAFGIPATAMAADASDDAPTTTIATREEQVKGQIGNTTPDFKREV
GPEGNSYIHSYGYKFYGTQKSADAINAWIKGEPFSPTGETELGTQTLTLPSGRVVQPGEI
VVLDVDGQNFSVVGNATVK
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagctcaccgccatcgcacctgccgctcttgctctaggcatcgcattcggaatc
cctgccaccgccatggccgctgatgctagcgatgatgctcctaccaccaccattgctact
cgtgaagagcaggttaaaggacagatcggtaatactacaccagacttcaagagagaggtc
gggcctgaaggcaattcctacattcatagctatggttacaagttctacggaactcagaag
tctgccgacgcaattaatgcctggattaaaggagaacccttctcccccaccggagaaact
gaactgggcacccagacactgacattgccctcaggacgtgtggtccaacctggtgaaatt
gttgttcttgacgtcgatggacagaacttcagcgtagtaggtaacgctactgttaaataa

DBGET integrated database retrieval system