KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2070Help
Entry
Cp1002_2070       CDS       T01876                                 

Definition
(GenBank) CAAX amino terminal protease
  KO
K07052  
uncharacterized protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2291584..2292213)
Genome map
AA seq 209 aa AA seqDB search
MISVIVVALYFFGSIALPSLVSPEWGERANQLGIIGSAVIGVILFRDRIAAGFRNLKGQW
LKFILITVILLFVQSGIIALGKKLFGGFGSSENQAGVEQALGGGNELLLNVLILALFAPI
IEELVFREAFIGWARGKVAITIAAIVSSVAFVVLHASESPEAMLLYVPGTLSLLAVYLIF
RKNIAAAMLAHIFNNSLSAIGLLAVSVMG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgatcagcgtgattgtcgtcgcgctctacttttttggctcgatagctctcccctccttg
gtgagcccggagtggggtgagcgggcgaaccagctgggaatcattggatccgccgtcatc
ggtgtcattcttttccgtgatcgcattgccgcgggcttccgcaaccttaaaggccagtgg
ctgaagtttatcctgataacagtaatcctactgttcgtgcagtccggcatcatcgctctg
ggaaagaaactctttggtgggttcgggtcttccgagaaccaggcgggagtggaacaagct
ctgggcggagggaacgaacttttgctgaatgtcttgattcttgcgctttttgccccgatc
atcgaggagctcgtcttccgtgaggccttcattgggtgggcacgtggcaaggtggccatc
actatcgcggcaatcgtctcgagcgtcgcgttcgttgtgctgcacgcctccgaaagcccg
gaggcgatgctgctctacgtccccggcaccctttccctgctcgccgtgtacctcattttt
agaaagaacatcgcggccgcgatgctggcccatatctttaacaactcgctttcggcgatt
ggactcttggctgtcagcgtgatgggttaa

DBGET integrated database retrieval system