KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2080Help
Entry
Cp1002_2080       CDS       T01876                                 

Gene name
crtB
Definition
(GenBank) Phytoene synthase
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SQS_PSY
Motif
Other DBs
NCBI-ProteinID: ADL21935
Position
2300463..2301656
Genome map
AA seq 397 aa AA seqDB search
MPRWPLRKIYHHLQALKPLTLPSSQKPVEGEASPSRHRRKLAATVFLGTFTALKKFCEET
SAKKGIKVPCEGISTIPNRTLNEKSPDATTLENFDQMSIKAAEKVITSYSTSFSFATYVL
EPELRTDIRNLYAMVRTADEIVDGTARAAGLTPIQTAKLLTHYEREVILAPTQRLHVDPV
MHAYAISARRCQFKQEHVRAFFASMRRDITSGECTTDEDYHGYIYGSAEVIGLMCLSAFL
VKRPSSRSQDADQRTYSYSQKELDIMGEGARALGAAFQKVNFLRDWQEDSTHLGRHYFPG
APSLLTDSFKQTIIADIRTDLTAAFQAIPLLPDSAKAGVTAAAELFTELTNILEATSAAE
IMKNRASVPLLTKMKIMARALIKARKFHPLANTRLTS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgttggcccctccgaaaaatttatcaccacttacaagcactcaaacccctaact
ttgccatcatctcaaaaacccgtagagggggaagcttccccctcccgccaccgacgtaag
ttagccgcgacagtgtttttagggacgttcacagccctgaaaaaattttgtgaagaaacc
tcagcaaagaaggggataaaggttccttgtgaaggtatctccacgatcccgaacagaact
ttgaatgagaaatctccggacgctactacacttgaaaactttgatcagatgtcgatcaaa
gctgccgaaaaagttatcacttcttattccaccagcttctcttttgccacttatgtcctt
gaaccggagttacgcaccgacatccgaaacctctatgccatggtgcgcacggcagatgag
atcgttgatggcaccgcccgcgcagcaggccttaccccaatacagactgcaaagcttctc
acacactacgagcgcgaggtgattctagcccccactcagagactgcacgtagatcctgtg
atgcacgcctatgccatttccgctcgtcggtgtcagtttaagcaagaacatgtacgcgcc
tttttcgcttctatgcgcagagatatcactagcggtgaatgcactacagacgaggactat
cacggttacatctatggctccgctgaagttatcggcctcatgtgtctatctgctttcttg
gtaaaacgccccagctcacgctcgcaggacgctgatcaacgcacatactcctattcccag
aaggaactcgacatcatgggcgagggtgcacgcgctctgggggcggcgttccaaaaagta
aattttctccgcgattggcaagaggactcaactcacctggggcgacattattttcccggc
gctcccagtctcctcaccgattcttttaaacaaacaatcattgcggatattcgcacagat
ctaacagctgcctttcaagccataccgctcttgccagattccgccaaggcaggagtaaca
gctgctgcagaattattcaccgaactaaccaatatccttgaggcaacgagcgcagctgag
attatgaagaatcgcgcgagcgtccccctcctcacaaaaatgaaaatcatggcgcgcgct
cttattaaagcccggaagtttcatccgttagcaaacacgcgtcttacctcttaa

DBGET integrated database retrieval system