KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2082Help
Entry
Cp1002_2082       CDS       T01876                                 

Gene name
trpF
Definition
(GenBank) Tryptophan-specific permease, 5-methyltryptophan resistance
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2303367..2303840
Genome map
AA seq 157 aa AA seqDB search
MTVVGTLLAIIAIALIIIGALAWTRRLPGNSYVGIRVPEVRKTQELWTTAHQVAGPLWVV
GGIAVGIAATLCFAPSGWLHLMSIIAVLAGILFVSIGANVGARAASLLDAQADAIAASES
TCCSAGGSADVEDETQTSTSFTPDLEALRRAAQASDN
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgactgtagtcggcacgcttttggccatcatagctatcgcccttatcatcatcggcgcc
ttggcatggacacgccgccttcccggaaattcatacgtggggattcgggtacccgaggta
cgtaaaactcaagagctatggaccaccgcacatcaagtcgccggacccctatgggttgtc
ggcggtattgctgttggtatcgccgcaaccttgtgttttgcgccttctggatggttgcac
ctcatgtccatcattgccgtcctcgcaggcatcttatttgtgagcattggggctaatgtg
ggcgcgcgtgcggcatcgcttctcgacgcccaagccgatgccatagccgcctcagagtcc
acgtgctgcagtgcggggggatcagcggacgtagaggatgagacgcagacgtcgacaagc
tttactcccgatctggaagcattacgacgtgcagcgcaggcttccgataactaa

DBGET integrated database retrieval system