KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2084Help
Entry
Cp1002_2084       CDS       T01876                                 

Gene name
trpG
Definition
(GenBank) Anthranilate synthase component II
  KO
K01658  
anthranilate synthase component II [EC:4.1.3.27]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Quorum sensing
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp1002_2084 (trpG)
  Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Cp1002_2084 (trpG)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Cp1002_2084 (trpG)
Enzymes [BR:cpk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Cp1002_2084 (trpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2305653..2306300
Genome map
AA seq 215 aa AA seqDB search
MNSTDTHVVLLDNHDSFVYNLLDAFAVAGYRCTVFRNSVGIKEILAAKPDIICLSPGPGH
PRDAGCMMELIDQTLGHIPVLGICLGFQALLEHFGGDVRACGPVHGITDLMKLNKQGLQS
PIFHGLTVDGFPGSQKGEHVPVARYHSLGCTEAPKELTVLGTCPSLIGPVAMAAEARAHA
AVGLQFHPESILSPSGPIILQRCIAHLSQYVKDHN
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgaccgacactcacgtagtacttctagataaccacgactcttttgtttataac
ctgctcgatgcctttgctgtcgcaggctatcgctgcactgtcttccgcaactcagtaggg
ataaaagagattctggcagccaagccagatatcatttgtctttccccaggccctggccat
cctcgagatgcaggttgcatgatggaacttatcgatcaaacgttgggccacatcccagtc
cttggcatttgcctaggattccaggcactcctagagcactttgggggagatgtccgcgca
tgtggccccgttcatggaatcacagatcttatgaagctgaataagcaaggcttgcagagc
cccatatttcacggcctgaccgttgacggctttcccggtagccagaagggtgagcatgtt
cccgtagctcgttatcattccctcggatgcacggaagccccaaaggaattaaccgtgttg
ggcacttgcccttcactcattgggccagtggcaatggcagccgaagcacgggcacatgcc
gctgtgggattgcaatttcatcccgagtcaatattaagcccttccggaccgatcatctta
cagcgctgcatcgcccatctttcccaatacgtcaaggaccataattaa

DBGET integrated database retrieval system