KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2085Help
Entry
Cp1002_2085       CDS       T01876                                 

Gene name
trpD
Definition
(GenBank) Anthranilate phosphoribosyl transferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpk01100  Metabolic pathways
cpk01110  Biosynthesis of secondary metabolites
cpk01130  Biosynthesis of antibiotics
cpk01230  Biosynthesis of amino acids
Module
cpk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp1002_2085 (trpD)
Enzymes [BR:cpk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Cp1002_2085 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ADL21940
Position
2306345..2307370
Genome map
AA seq 341 aa AA seqDB search
MTSETTKKKLIAYFDTPHPTVEEAIEVFTPLTIGDYDDVHIAALLATIRTRGETYADIAG
AAHAFLAAGRPFPITGSGLMDTAGTGGDGANTINVTTAASLVAASGGVQMVKCGNRSVSS
KSGSADVLEALNIPLDLDPDRAVRQFQASNFTFLFAPAYNPAVAHVQPVRKALRVPTLFN
VLGPLLSPARPEFQLMGIANPALGPIIAKVFRNLGRTRALVVHGSGIDEVAVHGPTTVWE
LDHGTITNYEVTPEELGIQRHNLTELEGGDGAENAALMRATFAGQGNPAHRDAIAATAGA
IFYTANLVESLREGTEKAKKLIKDGHVQQWLATHEEADYAK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgaaaccacgaagaaaaaactgattgcgtattttgacactccacatcccacc
gtggaagaggccatagaggtttttacccccttaacaattggcgactacgacgatgtccac
atagcagcactcttggccaccatacgcacacgcggtgaaacctacgcagatattgccggg
gccgcacatgcattcctcgctgcagggcgacctttccctatcacaggttccggattaatg
gacaccgcaggcaccggaggagatggtgcaaatactatcaatgtgaccacggcagcttct
ctcgtagcagcatctgggggagtgcaaatggtcaaatgcggtaaccgctcagtctcttcc
aaatctggatcagctgatgttttagaggcgcttaacattccactagatctagaccccgac
cgtgccgtccgacaattccaagcctctaatttcacatttcttttcgccccggcctacaac
ccggcagtagctcacgtacaacctgtccgaaaagctctgagagtccccactctttttaat
gtcttaggaccgctactttctccggcgcgccccgaatttcagctgatgggcattgctaat
cccgcgcttggccccatcatcgctaaggtattccgcaacctagggcgtactcgagccctg
gtagtccacggctctggcatagacgaggtcgctgtacatggccctaccaccgtatgggaa
ctcgatcacggcaccatcactaattatgaagtcacaccagaagaacttggaatccagcgc
cataaccttaccgagctggagggtggagacggcgcggaaaatgctgctttgatgcgtgcc
acgtttgcaggccagggaaaccccgcgcatagggatgccatcgcagctactgccggagca
attttctataccgcaaatctagtggaatctctgcgtgaaggaaccgagaaagccaaaaag
ctgattaaagacggacacgtacaacaatggctagcgacccatgaggaagccgattatgca
aaataa

DBGET integrated database retrieval system