KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2085Help
Entry
Cp1002_2085       CDS       T01876                                 

Gene name
trpD
Definition
(GenBank) Anthranilate phosphoribosyl transferase
  KO
K00766  
anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp1002_2085 (trpD)
Enzymes [BR:cpk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     Cp1002_2085 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
2306345..2307370
Genome map
AA seq 341 aa AA seqDB search
MTSETTKKKLIAYFDTPHPTVEEAIEVFTPLTIGDYDDVHIAALLATIRTRGETYADIAG
AAHAFLAAGRPFPITGSGLMDTAGTGGDGANTINVTTAASLVAASGGVQMVKCGNRSVSS
KSGSADVLEALNIPLDLDPDRAVRQFQASNFTFLFAPAYNPAVAHVQPVRKALRVPTLFN
VLGPLLSPARPEFQLMGIANPALGPIIAKVFRNLGRTRALVVHGSGIDEVAVHGPTTVWE
LDHGTITNYEVTPEELGIQRHNLTELEGGDGAENAALMRATFAGQGNPAHRDAIAATAGA
IFYTANLVESLREGTEKAKKLIKDGHVQQWLATHEEADYAK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtgaaaccacgaagaaaaaactgattgcgtattttgacactccacatcccacc
gtggaagaggccatagaggtttttacccccttaacaattggcgactacgacgatgtccac
atagcagcactcttggccaccatacgcacacgcggtgaaacctacgcagatattgccggg
gccgcacatgcattcctcgctgcagggcgacctttccctatcacaggttccggattaatg
gacaccgcaggcaccggaggagatggtgcaaatactatcaatgtgaccacggcagcttct
ctcgtagcagcatctgggggagtgcaaatggtcaaatgcggtaaccgctcagtctcttcc
aaatctggatcagctgatgttttagaggcgcttaacattccactagatctagaccccgac
cgtgccgtccgacaattccaagcctctaatttcacatttcttttcgccccggcctacaac
ccggcagtagctcacgtacaacctgtccgaaaagctctgagagtccccactctttttaat
gtcttaggaccgctactttctccggcgcgccccgaatttcagctgatgggcattgctaat
cccgcgcttggccccatcatcgctaaggtattccgcaacctagggcgtactcgagccctg
gtagtccacggctctggcatagacgaggtcgctgtacatggccctaccaccgtatgggaa
ctcgatcacggcaccatcactaattatgaagtcacaccagaagaacttggaatccagcgc
cataaccttaccgagctggagggtggagacggcgcggaaaatgctgctttgatgcgtgcc
acgtttgcaggccagggaaaccccgcgcatagggatgccatcgcagctactgccggagca
attttctataccgcaaatctagtggaatctctgcgtgaaggaaccgagaaagccaaaaag
ctgattaaagacggacacgtacaacaatggctagcgacccatgaggaagccgattatgca
aaataa

DBGET integrated database retrieval system