KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2087Help
Entry
Cp1002_2087       CDS       T01876                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cp1002_2087 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp1002_2087 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp1002_2087 (trpB)
Enzymes [BR:cpk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp1002_2087 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
2309243..2310493
Genome map
AA seq 416 aa AA seqDB search
MTLSYNKTTQQTLLPAYFGEFGGQFVPESLLPALDQLEKAFVEAQEDPHFHKELAGYLKD
YLGRPTPLTECSKLPLQGKGKGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKKRII
AETGAGQHGTATALACALLNLECVIYMGAKDVERQQPNVYRMELMGATVVSVDSGSGTLK
DAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQMLERTGGLPDVV
VACVGGGSNAIGMFADFIEDASVELVGAEPGGEGLSSGKHGATINNGRIGILHGAKSYLM
RNSDGQVEESYSISAGLDYPGVGPQHAHLSQSGRATYVAITDAEALEAFQLLSREEGIIP
ALESSHALAYALKRAALAEDEGKNITILVSLSGRGDKDIDHIRKTLAANPELSLKD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcttacaacaaaaccactcagcaaacactccttcctgcatactttggggag
ttcggcggacagtttgtccccgagtcactccttccagcgcttgatcagcttgaaaaagct
tttgtcgaggcccaagaagacccacactttcacaaagaactagcgggctatctcaaagac
tatttgggaagaccaactccattaacggaatgctccaagctacctttacagggaaaaggt
aaaggatatgcgcgcatcttccttaaacgcgaagaccttgttcacggtggagcacataaa
acaaaccaagttatcggccaggctcttttagctaagaggatgggtaaaaagcgcatcatc
gcagaaactggtgccgggcaacatgggacagcaaccgcccttgcatgcgcacttttaaac
ctcgaatgcgtcatttacatgggagctaaagacgtggaacgtcaacagcccaatgtgtat
cgcatggagcttatgggagctactgtggtgtccgtagattcaggttccgggacactcaaa
gatgcggttaatgaggccctgcgcgattggaccgcaacgttccacgaatcccattatctg
ctcggtacggcagccggacctcatccgtttcccacgatcgtccgagaatttcatcgtgtc
atttcagaggaagctaaagcacagatgcttgagcgcaccggcggactcccggatgttgtg
gttgcttgcgtgggcggaggctccaacgcaataggtatgtttgcagacttcattgaggat
gcatctgtagaactcgttggtgcggaacccggcggtgagggattatcgtccggaaagcac
ggtgcaaccattaacaatggacgtatcggtatcctgcacggtgccaaaagctatttgatg
cgaaattctgatggtcaagtggaagaatcctattccatttccgccgggctggattatccc
ggagtcggtccacagcacgcgcacctatcacagtctgggcgagccacctatgtggccatc
acagatgccgaggcgcttgaagccttccaattactttcccgtgaagagggaatcattcca
gcattagagtccagccacgccctcgcatatgcgttgaaaagagctgccctcgcggaggat
gagggtaagaatatcaccatattggtctccctttcagggcgtggcgataaagacatcgat
cacattcgcaagactctagctgccaaccccgagctttccctcaaggactaa

DBGET integrated database retrieval system