KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2091Help
Entry
Cp1002_2091       CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADL21946
Position
2312904..2313218
Genome map
AA seq 104 aa AA seqDB search
MASYLYVQTLMSIPGVGTSNHIAELEPINATECLLHRLLEVDPANAVCGAARGKTVVGMA
APPHSTVPHPESYADFPDIEASYLSSEEFEALWSEAVAKFPEIH
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttatctttatgtgcagacactaatgtctatccccggcgtaggaacaagcaat
catattgcagagttagaacccatcaacgccaccgaatgccttttacacaggcttcttgaa
gtagatcccgccaatgcggtctgtggggcagctcgtggcaaaacggtagtgggaatggcg
gcaccaccacacagcacagtcccacacccagagagttatgcagactttccagacattgaa
gcctcatacttatcatcagaagaatttgaagcgctttggtctgaagcagtagcaaaattc
cctgagatacactaa

DBGET integrated database retrieval system