KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2094Help
Entry
Cp1002_2094       CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
  KO
K07735  putative transcriptional regulator
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
Transcription factors [BR:cpk03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Cp1002_2094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF179
Motif
Other DBs
NCBI-ProteinID: ADL21949
Position
complement(2314500..2315105)
Genome map
AA seq 201 aa AA seqDB search
MQDMYADRLFNAMERNQPAPGMLLIAAPSMEDPVFARSVILLLEHNEATTFGVNLASRSD
VAVFNVMPEWAPLVSKPQALYIGGPLNQQGVIGIGVSAPGVDIVSHPHFNRLANRLVHVD
LRTQPEDVAADLSGLRLFAGYAEWEPGQLNEEIEKGEWYVAPALSSDVTAAGNVDVWGDV
MRRQPMPLPLYSTYPMDVSEN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggatatgtatgcagatcggttgttcaacgctatggagcgcaatcaaccggctccg
gggatgctgctcattgcagcgccttccatggaggatcccgtgtttgctcggagtgtcatt
ttgcttcttgagcataatgaggcaaccacgttcggcgtaaaccttgcgtcccgcagcgac
gtcgccgtgtttaacgtcatgccggaatgggctcctttggtttctaaacctcaggctctt
tatataggtggtccccttaatcagcaaggggttatagggataggggtctctgcacccgga
gtggatatcgtttcgcatccgcatttcaatcgtttggctaatagattggtgcacgtagat
ctgcgtacgcaaccggaagatgtagccgcagatctttcgggactgcgtctttttgccggt
tatgcagaatgggaaccagggcaattgaatgaagagattgaaaagggtgaatggtatgtt
gcgcccgctttgtcttccgatgtgactgctgctggaaatgtggatgtttggggtgatgta
atgcggcgccagccgatgccactccccttgtattcgacgtatcctatggacgtatcggaa
aactaa

DBGET integrated database retrieval system