KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2099Help
Entry
Cp1002_2099       CDS       T01876                                 

Gene name
sigM
Definition
(GenBank) RNA polymerase sigma factor sigM
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
Transcription machinery [BR:cpk03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Cp1002_2099 (sigM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r2 Sigma70_r4_2 Sigma70_ECF Sigma70_r4
Motif
Other DBs
NCBI-ProteinID: ADL21954
Position
2325075..2325701
Genome map
AA seq 208 aa AA seqDB search
MHCAVASTTIEHDASGTKTKLCRSKTHDSDLVLQFLEGDNQAFNEIAKRHYRSLWWLARR
HSYCDSDADDIMQEAMLKAVRSLERYRGDSSLNTWLYRLVFNTAYDHIYRCTHRDNLPLE
PLMETRSRLDCELSHDPFKDHALSMEVAQAVNMLPSEQRNAILLVDFAGYDVDVAAQIEK
VRPGTIKSRRARARKTLRSLLNPVFEEL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgcactgtgcagtcgcgtccaccacgatcgagcatgatgcatccggaactaaaacaaag
ctgtgtcgctcaaagacccacgactctgatctcgttctacagttcctggaaggcgacaat
caagcttttaatgaaattgctaagcggcactaccgtagtctgtggtggcttgcacgtcgg
cacagctactgcgattctgatgccgacgacatcatgcaggaagcaatgctcaaggctgta
cgcagcctagagcgataccggggagattcttccttaaatacctggctttatcggcttgtc
tttaacacggcctacgaccatatttatcgatgcacgcatcgagacaatcttccgttagag
ccactcatggaaacacgctcccggctagactgcgagcttagccatgatccattcaaggat
cacgctctgtccatggaggtagctcaagccgtaaacatgctgccctccgagcagagaaat
gccatcctcttagtcgattttgctggatacgacgttgacgttgccgcacagatagaaaaa
gttcgaccgggaacgatcaaatcgcgtcgggcgcgggcgcgaaagactctgagaagtctt
ctcaatcccgtattcgaagagctttag

DBGET integrated database retrieval system