KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2102Help
Entry
Cp1002_2102       CDS       T01876                                 

Gene name
cwlM
Definition
(GenBank) N-Acetymuramyl-L-Alanine Amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Pathway
cpk01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:cpk00001]
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Cp1002_2102 (cwlM)
Enzymes [BR:cpk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     Cp1002_2102 (cwlM)
Peptidoglycan biosynthesis and degradation proteins [BR:cpk01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   Cp1002_2102 (cwlM)
Chromosome and associated proteins [BR:cpk03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Cp1002_2102 (cwlM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 PG_binding_1 PG_binding_2
Motif
Other DBs
NCBI-ProteinID: ADL21957
Position
2327345..2328526
Genome map
AA seq 393 aa AA seqDB search
MSDILRVGDHSPRVAEVRTALTRLGLVPDSDKEIKQSKGQTFTDPETYFDEDLAEVIKGM
QQARGIIASGEINEVTLRALREASYKLGARVLSFEPNNIFVGDDVVQLQTQLQELGFYTD
RVDGRFGENTYKALLSYQVNYGLKSDGVCGPETIRAFGRLGRRITGGSPQALRERERVRD
AGPMLAGKRVVIDPSLGGNSRGQVVQGPYGEITEEEILWDLATRVEGRMIAAGMETIISR
PRQDNPSHLERADIANAFDADVMICLQCDQYQNDKANGVATFYFGSEAGTSSLTGEMLSG
FIQREISARTDLVNCGNHGRTWDLLRITAMPTIEVVLGYLTNPHDVTILTDPKHRDAIAE
AIVVAVKRLYLLDDDDQPTGTYKFAEMLEQGML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgacatcttgcgagtaggtgaccacagcccgcgcgtcgctgaagtcagaacagca
ctgacacgccttggtcttgtgccggactctgataaagaaatcaagcagtctaaggggcaa
acgttcactgacccagagacttactttgacgaggacctcgccgaagtaattaaggggatg
caacaggctcggggcatcatcgctagcggtgaaatcaatgaggtcacactccgtgccctc
cgcgaggcatcctataagctcggtgcccgagttcttagctttgagccgaataatatcttt
gttggcgacgacgtagtgcagttgcaaacgcagcttcaagagctcggtttttataccgat
cgcgtcgatggcagatttggtgaaaacacatacaaggcgttgctcagttatcaggtcaat
tatggactgaagagcgatggtgtctgcggccctgagacaatccgtgcgtttggacgtctt
ggacgcagaatcaccggcggttcgcctcaagcgcttcgtgagcgcgagcgtgtccgcgat
gccggccctatgctcgccggtaaacgcgtagttatcgacccctctttgggcggtaactca
cgtggacaagtggttcagggaccttatggggagatcactgaagaagaaattctatgggat
cttgctactcgggtagagggacgcatgatcgctgccgggatggagaccattatttccagg
cctaggcaggataatccttcacaccttgagcgtgcagatatagccaatgcttttgacgct
gacgtcatgatttgtttgcaatgcgaccaatatcaaaatgataaagcaaacggcgttgcc
actttttatttcggttctgaggccggaaccagctcccttaccggcgagatgctgagtgga
ttcatccagcgagagatcagcgctcgcactgatctggtcaactgcggtaaccacggcagg
acctgggatctgctccgtatcactgccatgcccaccatcgaagtggtcttgggttatctc
actaatccccacgacgtcaccattttgactgatcctaagcatagagacgcgatcgcagaa
gcaatcgtggtggccgtcaagcgcttatatctcctcgatgatgatgatcagcccacaggc
acgtacaagttcgcagagatgctagaacagggcatgctctaa

DBGET integrated database retrieval system