KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2103Help
Entry
Cp1002_2103       CDS       T01876                                 

Definition
(GenBank) Hypothetical protein
Organism
cpk  Corynebacterium pseudotuberculosis 1002
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2328577..2329176)
Genome map
AA seq 199 aa AA seqDB search
MFWELEESAALRASAAGTPTLEKEAWLAAMLSAYGTCGFNITSADNFASGNPRAYATLLY
CPASEAPGCARLPTAPLTSDAYVLTSLHCDPNMVGSGLETMLLDAAIVHLARQGIKALEA
FARDESFCDDPFHPQPENIQRIVNSAEEIGLMTVELLESAGFEIIRHHPVLPLLRLHLPP
EHALLTVEAIEPLLANVTV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgttctgggagttggaagaatcagcagcgttgcgtgcctctgctgctggtacgcctaca
ttggaaaaagaagcttggttagccgctatgctgtctgcatacggaacctgtggcttcaat
atcacaagcgcagacaatttcgcctcgggtaatcctcgagcctatgcgactctcctctat
tgcccagcctctgaggctccagggtgcgctcgactgcctacggctcccctaactagtgac
gcctatgtgctgacctctcttcactgtgatcccaacatggtgggcagtggtctagaaaca
atgcttctcgacgcagccattgttcaccttgcaagacaaggaataaaagcccttgaggct
tttgctcgggacgagtccttttgcgacgatccctttcatccacaaccagagaacatccag
cgcatagtgaactctgcggaggagataggactgatgacggtggaattattggagtctgct
gggtttgagatcattcggcatcatcccgtgttacctctcctacgccttcacttacctcca
gagcatgcgctactcaccgttgaagcaatagaacctctgcttgccaacgtgacagtgtaa

DBGET integrated database retrieval system