KEGG   Corynebacterium pseudotuberculosis 1002: Cp1002_2104Help
Entry
Cp1002_2104       CDS       T01876                                 

Gene name
parB
Definition
(GenBank) Chromosome partitioning protein ParB
  KO
K03497  
chromosome partitioning protein, ParB family
Organism
cpk  Corynebacterium pseudotuberculosis 1002
Brite
Transcription factors [BR:cpk03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Cp1002_2104 (parB)
Chromosome [BR:cpk03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Cp1002_2104 (parB)
Cytoskeleton proteins [BR:cpk04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   Cp1002_2104 (parB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2329286..2330338)
Genome map
AA seq 350 aa AA seqDB search
MAQETRKGGLGRGIGALITGSPAPGQRIGASAADVVFGGAAEKKKQSHSPRDAKGARISP
IIAQAVEKQSAGSRGADQQLEEFGATYREIPIGLIIPNEKNPRSVFDEEDLAELVHSIRE
FGLLQPIVVREAADDRYEIIMGERRWRASSKAGLKTIPAIVRKTDDSEMLRDALLENIHR
VQLNPLEEAAAYQQLLQEFGVTQNELADKLGRSRPVITNMIRLLALPVAVQRKVAAGVLS
AGHARALLGVKGGEAPQVALADRIVAEGLSVRATEEAVTLMNRGEKPAPKKREKAPTPEF
LTNAANRLADGLDTKVSVSMGKRKGKIVVEFGGREDFDRIMGLLGGNSEG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggaaactcgtaaaggtggtctcggtagaggaattggcgcgctgataaccggt
agtcccgcaccgggacagcgaatcggcgcctctgcggcagacgtggtttttggtggtgcg
gccgagaaaaagaaacaatcgcattccccacgcgatgccaaaggcgctcgcattagccct
atcattgcgcaagccgtggaaaaacagtctgcaggctcgcggggagcagaccagcaactt
gaggaattcggcgctacctaccgggagattcccattggattaattattcccaatgagaaa
aaccctcgtagcgtttttgatgaggaagaccttgccgagctggttcattccatccgcgag
tttggactactccagcccatcgtggtccgtgaggctgccgatgatcgctatgagatcatc
atgggtgagcgtcgttggcgtgcgtcctccaaagctggtctgaagactattcccgcaatc
gtccgtaaaaccgacgactcggagatgctgcgcgatgctctcttggagaacattcatcgt
gttcagcttaaccccttggaagaagcagctgcctatcagcagctactgcaggaatttggc
gttactcagaatgaactagcggataaacttggtcgctcccgtccagtaatcaccaatatg
attcgcttgctcgcccttccagtagcagtgcaacgcaaagtagcggccggtgtgctttcc
gctggacacgctcgggcgctcctgggtgtaaaaggcggtgaagcgcctcaggttgctctg
gccgaccgtatcgtcgctgaggggctttctgttcgagcaacagaagaagccgtcacgttg
atgaaccgtggtgaaaaaccagcaccaaagaagcgggaaaaggctccaactcctgagttc
cttaccaacgctgcaaaccgtcttgcagacgggctagacaccaaagtgtctgtgagcatg
ggaaagcgtaaaggaaaaattgttgtggagtttggtggtcgtgaagattttgaccgcatt
atgggactgcttggcggaaacagcgaaggataa

DBGET integrated database retrieval system