KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_0277Help
Entry
Cp3995_0277       CDS       T01689                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cp3995_0277 (hemB)
Enzymes [BR:cpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Cp3995_0277 (hemB)
Exosome [BR:cpl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cp3995_0277 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
289169..290116
Genome map
AA seq 315 aa AA seqDB search
MRELVAETTLRPADLILPMFVADGIAEPREISSMPGVYQHTIPSLIEAVREAISVGIKCI
DLFGVPLDADKDAQGSQSWAPDGILNRGIRALRQEFGNDVIIMADTCLDEFTDHGHCGVL
DTDRFGEAVVDNDATIPLYQKMAVAQAEAGAHMVSPSGMMDGQILAIRDALDAHGFQDVA
IMAYSAKYASAFYGPFRDAVGSSLDGDRRTYQQDPANCRESLMEVDLDIEEGADFVMVKP
AMPYLDVLAEVASTSSVPVAAYQVSGEYAMLHAAARNNWLDLERVMMESLISIKRAGADQ
ILTYFAVDAAKKLQH
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaattagtggcagagacgacgcttcgtcccgccgacctgattcttcctatgttt
gtcgcagacgggatagctgagccacgcgaaatttcttctatgcccggcgtataccagcac
actattccctccttaatcgaggccgttagagaagctatttccgtagggattaagtgcatt
gacctcttcggagtgcctctcgacgccgacaaggacgcacagggttctcaatcttgggca
ccagacggaatcctcaaccgtggcattagagcgttacgccaagagtttggcaatgatgtg
atcatcatggcagacacgtgtcttgatgagttcacagatcatgggcactgcggcgtactc
gacactgatcgcttcggcgaggcagttgtggataacgatgccactatcccgttgtatcaa
aagatggcggtggcgcaagcggaggcaggcgcgcacatggtaagcccctccggcatgatg
gatgggcagattttggcaatccgcgacgccctcgatgctcatggcttccaagacgtagcc
attatggcgtattccgctaagtatgcttcggccttctacggcccattccgtgacgcagtg
ggttcttctttggacggcgaccgtagaacataccagcaggatccggctaattgtagggaa
tcactgatggaagtcgacctagatattgaggagggcgcggactttgttatggtcaaacca
gccatgccttacctcgatgtcctagcagaggtagcctcaacatcgtccgtgcctgtcgcc
gcgtatcaggtatcaggcgaatatgccatgttgcatgcggctgcccgtaataactggctc
gatctggaacgtgtgatgatggaatcgttgatttctatcaaacgcgctggggcagaccag
attcttacttactttgccgtcgacgcggcgaaaaaactacagcactag

DBGET integrated database retrieval system