KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_0281Help
Entry
Cp3995_0281       CDS       T01689                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cp3995_0281 (hemY)
Enzymes [BR:cpl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Cp3995_0281 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
294576..295961
Genome map
AA seq 461 aa AA seqDB search
MRIAIIGAGLAGLTAAYEIHKLAPHADVEVFEATDRIGGKLFTVPFASGPTDMGAEAYLV
FREDTTEFFKELGLEESLRSPSGLPSLLYQGGSLHSMPSNTIMGIPGTSEDLGNLVSEET
RKRIDSEINAESIEWPQEISLGALLRERLGDDVVDHVVSTLQGGVYSSTSDDLSVRATVP
QLARALDKLKEEGKPVTITGAVQRLLSEREERNKKRGYTPSVFASFAGGYAEMYEALAER
SEAKIHIDAFITAVDKKPEGFVLKGAEGVFDKVLLTVPAPTAALLLKNLVPEAAQQLKTI
KLASSAVVGMKFDNSAGLPDNSGILVATNAQDVRAKAFTFSSKKWPHLGERGGALVRASF
GRFGEDAIARADEDELVDAALDDLQTITGFDGRAAGLSEIFVQRWFGGLPVYGPGHLDTV
AAIKKALAQVEGIDATGAWADGVGVPAVIDAAKAAAKRALA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcattgccatcatcggtgccggtttagcggggctaacggctgcttatgagattcat
aaactcgcccctcacgcggacgtagaggtgttcgaggcgacagatcgaattggcggcaaa
ctgttcacggttccgtttgcctccggtcctactgatatgggcgcagaagcatatttagtt
tttcgggaagataccactgaatttttcaaagagctaggactcgaggagagtttgcgttct
ccctcggggttgccttctttgctataccagggaggcagccttcatagcatgccttccaac
acgatcatgggtatccccggcacaagtgaggacctaggtaacctggtcagcgaggaaact
cgcaaacgcattgactcggaaataaacgcggagtctattgagtggcctcaagaaataagc
ctgggtgcactcctgcgggaacgcttgggtgatgatgttgtagatcatgtggtgtcgacg
ctgcaaggtggcgtttattcttctacctcggatgatctcagcgtgcgcgctacggtaccg
cagctagcgcgggccttagacaagctcaaagaagagggaaagcccgtaaccatcacgggt
gctgttcaacggcttttgtctgagcgagaggaacgtaacaaaaaacggggatataccccg
agcgtttttgcgtctttcgcaggcggttatgcggagatgtatgaggctcttgctgagcgt
agcgaggcaaagatccacatcgatgcctttattaccgcagtggataaaaagcctgagggt
tttgtgctcaagggtgctgaaggggtctttgataaagtcctgttgacggtgccggcgccc
acggcggctctgctgcttaagaaccttgttccggaggctgcacaacagcttaaaactatc
aagctagcgagctctgccgtggtaggaatgaagtttgataattccgcgggactccccgat
aactctgggattcttgttgccactaatgcccaagatgtgagggcaaaagcattcaccttc
tcctctaagaagtggcctcacctgggggaacgtggcggtgctttagtgcgggcctctttc
ggtaggtttggtgaggacgctatcgcgcgcgcagacgaagacgagcttgtcgacgcagcc
ctcgacgacctacagaccattacgggattcgacggacgtgctgctggattatcggagatc
tttgtccagcgatggttcggcgggttgccagtgtatggtcctgggcacttggacacggtt
gcagcaatcaagaaagcactggctcaggtcgagggcatcgatgctactggtgcgtgggcc
gatggcgtcggcgttcccgcagtgatcgatgctgcgaaagcagcggccaaacgagcactt
gcctaa

DBGET integrated database retrieval system