KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1175Help
Entry
Cp3995_1175       CDS       T01689                                 

Gene name
aspS
Definition
aspartyl-tRNA synthetase
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cp3995_1175 (aspS)
Enzymes [BR:cpl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Cp3995_1175 (aspS)
Amino acid related enzymes [BR:cpl01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Cp3995_1175 (aspS)
Transfer RNA biogenesis [BR:cpl03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cp3995_1175 (aspS)
 Prokaryotic Type
   Other AARSs
    Cp3995_1175 (aspS)
Mitochondrial biogenesis [BR:cpl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cp3995_1175 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1258252..1260045)
Genome map
AA seq 597 aa AA seqDB search
MLRTHLAGDLRKDTAGQTVTLTGWVSRRRDHGGVIFIDLRDSSGLVQVVFRENDVAEKAH
HLRSEFCIKVTGVVEARPEGSENPNLASGEIEINVNDLEILNEAAALPFQIDDASQSGGE
VGEEARLKYRYLDLRRPTQGGALRLRSKANQAARRVLDTHDFVEIETPTLTRSTPEGARD
FLVPARLKPGSWYALPQSPQLFKQLLMVAGMEHYYQIARCYRDEDFRADRQPEFTQLDIE
MSFVDQDDVIALAEEIVSELWKLIGYNIPTPIPRMTYADAMRLYGSDKPDLRFDIKIVEC
TDYFKDTTFRVFQNEYVGAVVMEGGASQPRRQLDAWQEWAKQRGAKGLAYILVGEDGELS
GPVAKNITESERAGIAAHVGAQPGDCIFFAAGDTKSSRALLGAARGEIARKLGLIKDGDW
AFTWVVDAPLFESSADATASGDVALGHSKWTAVHHAFTSPKPEWLESFDENPGEATAYAY
DIVCNGNEIGGGSIRIHRRDVQERVFKVMGITEEEAREKFGFLLDAFAFGAPPHGGIAFG
WDRIVSLLGGFDSIRDVIAFPKSGGGVDPLTDAPAPIPLEQRRETGVDFKPKKKSAE
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgcactcatctcgcgggtgatctccgtaaggataccgctgggcagactgttacc
ctcactggttgggtttctcgccgtcgtgatcacggtggcgttatctttatcgacctgagg
gattcttccggccttgttcaagtggtcttccgtgagaacgacgtcgctgagaaagctcac
catttacgcagtgaattctgtatcaaggttactggtgtggtggaagctcgccccgaagga
tctgagaatcctaacctggcatcgggtgagattgagattaatgttaacgatcttgagatc
ttgaatgaagcagcagcactgccgttccaaatcgatgatgcatctcaaagcggcggggaa
gtgggagaggaggcaagactcaagtatcgctatctcgaccttcgacgtcctactcagggc
ggagcactgcgcctgcgttcaaaagctaaccaggcagcacgacgagtgctcgatacccat
gattttgtggagatagagactcccaccttgactcgttccacgcccgaaggtgcgcgagat
ttcctagtacctgctcgcttgaagcccggttcatggtacgcgcttccacaatcgccacag
cttttcaaacagctgctgatggttgcaggtatggaacattattatcagattgcacgctgc
taccgtgacgaggacttccgtgctgatcgtcagccagagtttactcagcttgacattgag
atgagctttgtcgaccaagatgatgtcatcgccctcgcagaagagattgttagcgaactc
tggaagctcatcggctataacattcctaccccgatcccgcgcatgacgtatgccgatgct
atgcgtctttatggctctgataagccagatctgcgttttgatatcaagatcgtagagtgc
actgactatttcaaagacaccaccttccgggttttccaaaacgaatacgtgggtgctgtg
gtcatggagggcggggcttcacaaccacgtcgtcagcttgatgcatggcaggagtgggct
aaacaacgtggtgcaaaaggccttgcatacattctggtgggagaagatggggagctgtct
ggtccggtagccaagaacattactgaatcagagcgcgcaggaatcgctgcgcatgttgga
gcacaaccaggcgattgcatcttctttgcggccggtgataccaagagttcccgagctctt
cttggtgcagctcgcggtgagatcgctcgcaaattgggccttatcaaggatggcgattgg
gctttcacctgggttgttgatgctcctttgtttgaatcttctgcagacgctactgcttcg
ggcgatgtagctcttggacattctaagtggacagcggtgcaccacgcgtttacttctcca
aagccagaatggctggaatcttttgatgagaaccccggagaggctacggcctatgcttac
gatatcgtgtgtaatggcaacgagatcggcggaggatcgattcgtattcaccgccgtgat
gtgcaagaacgcgtcttcaaagtgatgggtatcacggaggaagaggctcgtgaaaagttt
ggcttcctgcttgacgcctttgcttttggcgctccgccacacggaggaatcgcctttggc
tgggatcgcatcgtttcgctcctaggcggcttcgactctatccgtgacgtcattgccttc
cctaaatccggtggcggagttgatcctctcaccgatgctcctgcgccgatcccactggaa
cagcgtcgtgagacaggggtagatttcaaacctaagaagaagtctgcggaatag

DBGET integrated database retrieval system