KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1175Help
Entry
Cp3995_1175       CDS       T01689                                 

Gene name
aspS
Definition
aspartyl-tRNA synthetase
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cpl00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1258252..1260045)
Genome map
AA seq 597 aa AA seqDB search
MLRTHLAGDLRKDTAGQTVTLTGWVSRRRDHGGVIFIDLRDSSGLVQVVFRENDVAEKAH
HLRSEFCIKVTGVVEARPEGSENPNLASGEIEINVNDLEILNEAAALPFQIDDASQSGGE
VGEEARLKYRYLDLRRPTQGGALRLRSKANQAARRVLDTHDFVEIETPTLTRSTPEGARD
FLVPARLKPGSWYALPQSPQLFKQLLMVAGMEHYYQIARCYRDEDFRADRQPEFTQLDIE
MSFVDQDDVIALAEEIVSELWKLIGYNIPTPIPRMTYADAMRLYGSDKPDLRFDIKIVEC
TDYFKDTTFRVFQNEYVGAVVMEGGASQPRRQLDAWQEWAKQRGAKGLAYILVGEDGELS
GPVAKNITESERAGIAAHVGAQPGDCIFFAAGDTKSSRALLGAARGEIARKLGLIKDGDW
AFTWVVDAPLFESSADATASGDVALGHSKWTAVHHAFTSPKPEWLESFDENPGEATAYAY
DIVCNGNEIGGGSIRIHRRDVQERVFKVMGITEEEAREKFGFLLDAFAFGAPPHGGIAFG
WDRIVSLLGGFDSIRDVIAFPKSGGGVDPLTDAPAPIPLEQRRETGVDFKPKKKSAE
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
gtgttgcgcactcatctcgcgggtgatctccgtaaggataccgctgggcagactgttacc
ctcactggttgggtttctcgccgtcgtgatcacggtggcgttatctttatcgacctgagg
gattcttccggccttgttcaagtggtcttccgtgagaacgacgtcgctgagaaagctcac
catttacgcagtgaattctgtatcaaggttactggtgtggtggaagctcgccccgaagga
tctgagaatcctaacctggcatcgggtgagattgagattaatgttaacgatcttgagatc
ttgaatgaagcagcagcactgccgttccaaatcgatgatgcatctcaaagcggcggggaa
gtgggagaggaggcaagactcaagtatcgctatctcgaccttcgacgtcctactcagggc
ggagcactgcgcctgcgttcaaaagctaaccaggcagcacgacgagtgctcgatacccat
gattttgtggagatagagactcccaccttgactcgttccacgcccgaaggtgcgcgagat
ttcctagtacctgctcgcttgaagcccggttcatggtacgcgcttccacaatcgccacag
cttttcaaacagctgctgatggttgcaggtatggaacattattatcagattgcacgctgc
taccgtgacgaggacttccgtgctgatcgtcagccagagtttactcagcttgacattgag
atgagctttgtcgaccaagatgatgtcatcgccctcgcagaagagattgttagcgaactc
tggaagctcatcggctataacattcctaccccgatcccgcgcatgacgtatgccgatgct
atgcgtctttatggctctgataagccagatctgcgttttgatatcaagatcgtagagtgc
actgactatttcaaagacaccaccttccgggttttccaaaacgaatacgtgggtgctgtg
gtcatggagggcggggcttcacaaccacgtcgtcagcttgatgcatggcaggagtgggct
aaacaacgtggtgcaaaaggccttgcatacattctggtgggagaagatggggagctgtct
ggtccggtagccaagaacattactgaatcagagcgcgcaggaatcgctgcgcatgttgga
gcacaaccaggcgattgcatcttctttgcggccggtgataccaagagttcccgagctctt
cttggtgcagctcgcggtgagatcgctcgcaaattgggccttatcaaggatggcgattgg
gctttcacctgggttgttgatgctcctttgtttgaatcttctgcagacgctactgcttcg
ggcgatgtagctcttggacattctaagtggacagcggtgcaccacgcgtttacttctcca
aagccagaatggctggaatcttttgatgagaaccccggagaggctacggcctatgcttac
gatatcgtgtgtaatggcaacgagatcggcggaggatcgattcgtattcaccgccgtgat
gtgcaagaacgcgtcttcaaagtgatgggtatcacggaggaagaggctcgtgaaaagttt
ggcttcctgcttgacgcctttgcttttggcgctccgccacacggaggaatcgcctttggc
tgggatcgcatcgtttcgctcctaggcggcttcgactctatccgtgacgtcattgccttc
cctaaatccggtggcggagttgatcctctcaccgatgctcctgcgccgatcccactggaa
cagcgtcgtgagacaggggtagatttcaaacctaagaagaagtctgcggaatag

DBGET integrated database retrieval system