KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1371Help
Entry
Cp3995_1371       CDS       T01689                                 

Gene name
mutM1
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Cp3995_1371 (mutM1)
Enzymes [BR:cpl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Cp3995_1371 (mutM1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Cp3995_1371 (mutM1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1466361..1467218)
Genome map
AA seq 285 aa AA seqDB search
MPELPEVEVVRRGLERHAVGRALTSVAVSHSRAARYVVGGPQELEARLRGRVLSSVHRRG
KFLWFVLDDSCALMVHLGMSGQMLIKQADASLHPHTRIRCSLSSGSEQSELWFVDQRTFG
YWRIAELVYSHNRLVPKPMAHIAADLLEPAQDLMATARLIKTKHLEIKRLLLNQEIVAGI
GNIYADEMLWSAQIHPRQKAHRLSLRAIHSLLNEGQRVMHNALLQGGTSFDSLYVNVNGE
SGYFDVSLQAYGQEGMPCTRCGTALVREKFSNRSSHFCPRCQRLQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgagttgccagaggtagaggttgttcgccggggacttgaacgccatgccgttggg
agggcgttaacttctgtggcagtctcacattctcgtgctgcacgctatgtagtaggcggc
cctcaggagcttgaggcgcggctacgcggacgagtgctttcctcggtgcatcggcgcgga
aagtttttgtggtttgttttggatgactcttgtgcacttatggtgcatctgggtatgagt
gggcagatgcttattaagcaagctgatgcctcattgcatcctcatacccggattcgctgt
tctcttagttctggaagcgaacagagcgaattatggtttgtggatcagcgtacgtttggc
tattggagaatcgccgaattggtctattcccataatcgattagttcctaagccaatggcc
cacatagcagccgatctattggaacccgcgcaagatcttatggcgacagcgcgactgatt
aaaactaaacatttagagattaaaagactgcttcttaatcaagagattgttgcgggaatc
ggtaatatatacgcagatgagatgctgtggtctgcgcaaatacaccctaggcagaaggcg
cacaggctttcattacgtgcgattcactcgctcttaaacgaaggacaaagagtgatgcat
aatgctctgctgcaaggaggaacaagttttgattcgctgtatgtcaatgtgaatggcgaa
tctggctattttgatgtttctttgcaggcttatggccaagaaggaatgccttgcacgcga
tgcggtacagcgttggtgcgggaaaagttttccaatcgttcaagtcacttttgtccacga
tgccagcggctgcaatag

DBGET integrated database retrieval system