KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1387Help
Entry
Cp3995_1387       CDS       T01689                                 

Gene name
trpC2
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
cpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpl01100  Metabolic pathways
cpl01110  Biosynthesis of secondary metabolites
cpl01130  Biosynthesis of antibiotics
cpl01230  Biosynthesis of amino acids
Module
cpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp3995_1387 (trpC2)
Enzymes [BR:cpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cp3995_1387 (trpC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh OMPdecase QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEX39844
Position
complement(1484608..1485417)
Genome map
AA seq 269 aa AA seqDB search
MPSVFEEIIAGVIEDVAARESVVSFKEIKARSRACEPPRDAIAALLNSGCGVIAEIKRAA
PDKGVLAEINSPVGLAKELVAGGASLIACQTERRRFHGSLSEMAEIRNVISVPIMCRDFI
VDPYQIHEARCYGADMVPLRVAALDQARMIALIDRIESLGMAALVEVRDTEEASRAVAAG
AKIIGVNARDFSTMTLNRLAFAEIAPGLPTDVIRVALSGVRNARELLDYAASGADAVVVG
EKIVTAADPCEATRSLVAAGQHPSCPSRG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagtcttcgaagagattattgcgggcgtcattgaagatgtagctgcgcgagaa
tcagtggtgtcgtttaaagagatcaaagcccgttcgcgtgcttgcgagccgcctcgggat
gcaatagcggcgcttcttaatagtggttgtggcgtgatcgctgagattaaacgtgctgcc
ccagataaaggcgttttagcagagatcaattctcctgttggcttagcaaaagaacttgtc
gccgggggcgctagtttgattgcgtgtcagacggaacggcgaaggttccacggttcatta
tctgagatggctgagattcgtaatgtgatatcggtgccaataatgtgccgagacttcatc
gtggatccctatcaaattcatgaggcgcgctgttatggagcggacatggtgcccttgcgc
gtagctgctttagaccaagccaggatgattgcgcttatagatagaatcgagtccctggga
atggcagcgctggtagaagtccgggatactgaggaagcatcgcgtgcggtggcagcgggt
gcgaagatcataggggtaaacgcccgggatttctcaacgatgacgctcaaccgcctggcc
ttcgcagaaattgctcctggacttcccacagatgttattagagttgcattgtccggtgtg
cgcaatgctcgtgaactcctggattacgctgcctctggtgcggacgcggtggttgtggga
gaaaaaattgttactgctgcggatccgtgcgaagcgacgcgttcgttggtggcagcaggc
caacatccatcgtgtccatcgcgaggataa

DBGET integrated database retrieval system