KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1466Help
Entry
Cp3995_1466       CDS       T01689                                 

Gene name
asnB
Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cpl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1568034..1569956
Genome map
AA seq 640 aa AA seqDB search
MCGLLGMLTSTRDAQRYVSAIEKSLPCMRHRGPDEAGTWHDQQAVFGFNRLSIIDLEHSH
QPLKWGPQGQTDRYAMTFNGEIYNYVELRAELQELGYTFNTSGDGETIVVGYHHWGAEVV
QHLRGMFGFAIWDSQEEKLFLARDQFGIKPLYYATTDAGTIFSSEKKCILEAAEDIGLDL
SLDQRAIEHYVDLQYVPEPESLHANIRRLESGCYGEIVPGGKVKQTRYFRPQFPAQEVPK
SKEQDLFDRIARALEDSVEKHMRADVTVGSFLSGGIDSTAIATLAKRHNPNLLTFTTGFE
REGYSEVDVAAESAAAIGVEHIVKVVSPEEYANAIPQIMWYLDDPVADPSLVPLFFVAQE
ARKHVKVVLSGEGADELFGGYTIYKEPLSLAPFEKIPSPLRRGLGQLAKVFPEGMRGKSL
LERGSMTMEERYYGNARSFNFEQMQRVLPWAKKEWDHREVTAPIYAQSTHMDPVARMQHL
DLFTWMRGDILVKADKINMAHSLELRVPFLDKEVFAVAETIPHSLKVTQGTTKYALRKAM
EQIVPPHVLHRKKLGFPVPMRHWLAGDELFGWAQDTITESLTDHIFDKKAVLDMLNEHRA
GVSDHSRRLWTVLAFMVWHGIFIENRIDPGIEKKDYPVYL
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggacttcttggcatgcttacgagcacaagggacgcccaaaggtatgtctcggcc
atcgaaaaatcgctaccgtgtatgcgtcacaggggcccagatgaggctggaacgtggcat
gaccagcaagccgtctttgggttcaatcgcctttctatcatcgatctagaacattcccat
cagccactaaaatgggggccgcaaggccaaactgatcgctacgcaatgacgtttaatggc
gaaatctataactatgtagagctcagggcagaactacaggaactcggttacacctttaat
acctcaggcgatggcgagaccatcgttgttggatatcaccactggggcgccgaggttgtc
caacacctgcggggcatgtttggctttgctatttgggattctcaggaggaaaagctcttc
ctcgcccgcgatcagtttggtatcaagccgctgtattacgcaaccacagacgccggcacc
attttttcctcggagaagaaatgcattttggaagctgccgaggatattggtctagacctc
agccttgatcaacgagctattgagcattacgttgatctgcaatacgtaccagaaccggaa
agtcttcacgcaaatattcgccggttagaatcaggctgttacggggaaattgtccccggc
ggcaaggtcaaacagactcgttatttccgtccccaatttccagcgcaggaagttcccaag
agcaaggaacaggatctttttgatcgaatcgcccgcgcgttagaggatagcgtcgaaaag
catatgcgtgccgacgtcaccgtggggtccttcctctccggtggcatcgattccactgcg
atagctacgttggccaagcgccacaaccctaatttgttgaccttcaccacaggttttgag
agagaaggttactcagaggttgatgttgccgcagagtctgctgcagcgatcggcgtagaa
cacatcgttaaggttgtgtcaccagaggaatacgccaacgccatcccccagattatgtgg
tacctggatgaccccgtagcagatccctcacttgtccccctcttctttgtggcccaagaa
gctaggaagcatgtcaaggttgtcctctccggcgaaggcgcggacgaacttttcggcggc
tacaccatttataaagagccgttgtctctcgccccctttgaaaaaatcccgtccccccta
cgtcgaggcctagggcaacttgccaaggttttccccgaaggcatgcgcggcaagtccttg
ttagagcgcggttccatgaccatggaagaacgctattacggcaatgctcgctcatttaac
tttgagcagatgcagcgcgttttgccatgggctaagaaggaatgggatcaccgcgaggtc
acagccccaatctacgctcagtccacgcatatggatccggtggcgcgcatgcagcacctt
gatctttttacgtggatgcgaggcgatattttggttaaagccgataagatcaacatggca
cattcccttgaactccgagttcccttcttggataaagaagtgtttgcggtcgccgagact
atcccccatagtctgaaggtcacacagggaaccaccaagtatgcgctgcgtaaggcaatg
gaacagatcgttccaccgcatgtcctgcaccgtaagaaactcggtttccctgtccccatg
cgccattggctagctggagacgagctattcggctgggctcaagacaccattacggagtca
ctcacggaccatatctttgataagaaagctgtcttggacatgctcaatgaacacagagca
ggagtcagtgaccattctcgtaggctatggactgttcttgcctttatggtgtggcatggg
atctttatagaaaaccgaatcgatcctggaatcgagaaaaaggactatccggtttatctc
tag

DBGET integrated database retrieval system