KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1576Help
Entry
Cp3995_1576       CDS       T01689                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cpl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1680792..1682978
Genome map
AA seq 728 aa AA seqDB search
MGYTELLRELAAAHAVSCSFTGFGGEVTEVSDDTLVKTLRALGVRFGNEPGDSPNDHMPL
DAPMPSEEQIRAAIQKRRDEEDTRPLPRCVVATQGDPYVFNVHVHDGSPADITITLEDGS
VAADVTQIENWTPPRTVDGITWGEASFQIPQDLPLGWHTITLTSDTLTASCFLIITPQQL
STARTFVENPATGVMAQLYSVRSNDSWGMGDFHDLGELAKVVADKADADYILVNPMHAAE
PFPPVEDSPYLPTTRRFINPIYIRVEDIPEYLSLNDELQKEIEEISSEFKALNHSSDKIE
RNPIYDAKLQVLHAIFEAERDPAREQDFRDFVASEGDGLYDFALWCADQEIAHLTASSSH
AAIPAPEEAAEFYMWLQWICDQQLGAAQSAAIDAGMSIGIIADLAVGIHPGGADAQSLAD
SLAPRASVGAPPDNYNQQGQDWSQPPWHPDRLAEAGCVPWRDLLRTVLRYAGGIRVDHIL
GLFRLFWIPRMQSPTTGAYVNYDHNALVGVLALEAERAGAVVIGEDLGTYEPWVQEFLAQ
RGIMGTSVLWFESSPTGGPRHQNEYRELALSSVTTHDLPPTAGLLAGEHIELRKELGILT
VDPEQEHEQDIRWQNEILDEVKHTGAFSGATVPEAFQGLNREERGSADTLIPAIHKFLAG
TPSALTCTSLVDLVGDRRAQNQPGTTSDMYPNWCIPLCDGNIQALTIEEIADLPLFQAVA
DASKRNKR
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
gtgggttatacagaattgctgcgcgaactcgcagcagcacatgcagtttcttgttcattt
accggattcggcggcgaagtaaccgaagtcagcgacgatacgctggttaaaacacttcgt
gcgttgggtgttcgctttggaaatgaacccggggacagtccaaacgatcacatgccgctc
gatgctcctatgccgagcgaggaacagatccgtgcagctattcagaagcgccgcgatgaa
gaagacacgcgcccgcttccccgctgcgtcgtcgctacgcaaggagacccttacgtcttc
aacgtacatgttcacgacggctcccccgcagacatcacaatcacgcttgaagacggctca
gtcgcagcagacgtcacccaaattgaaaactggacaccaccgcgcactgtcgacggcatc
acatggggcgaagcctctttccagatcccacaggatctccccttaggctggcacaccatc
acgctgacctccgacacgctcactgccagctgtttcctcattatcaccccgcagcagctc
tccaccgcgcgcacgtttgtggagaacccagccactggagttatggctcagctctattca
gtgcgcagcaatgactcgtggggaatgggagacttccatgacctcggcgagttggccaaa
gttgtggccgacaaagctgacgctgactatattttggtcaacccgatgcatgcagccgag
cccttcccgccagtcgaggactccccttatctccccaccacgcgacgctttattaatccc
atctacatccgcgtggaggacatacccgagtacctcagccttaacgatgagttgcaaaag
gaaatcgaggagatttcttctgagtttaaggctctcaaccactccagcgataaaattgaa
cgcaacccgatctatgacgcaaagctccaagtgcttcatgcaatttttgaggccgagcgc
gatccggcacgtgaacaggacttccgcgattttgtagcctctgaaggtgatggcctctac
gacttcgcgttgtggtgtgcagatcaagaaatcgctcaccttacggcatccagctcccat
gctgctatccccgctccagaggaggccgcagaattctacatgtggcttcagtggatctgc
gatcagcagctgggtgcagcgcaatcagctgctatcgacgcaggcatgagcataggaatc
atcgccgacctcgccgtggggatccaccctggcggtgccgacgcccaaagccttgccgac
tctctagcgccacgcgcatccgtcggcgccccgcctgataattacaatcagcaaggacaa
gactggtctcagccaccatggcatcccgaccgtcttgctgaagccggctgcgtgccatgg
cgcgatctgcttcgcaccgtcctgcgttatgccggaggtattcgagtagaccatatccta
gggcttttccgtctcttctggatcccccgcatgcaatcccccaccaccggggcttatgtc
aactacgaccacaatgctctggtcggcgttctcgcgcttgaagcagagcgtgctggcgca
gtagtgataggtgaggacttaggcacatacgagccatgggttcaggagttccttgcacaa
cgcggaatcatgggcacatcggtgctttggtttgagagttcccccacgggtgggccgcgg
caccaaaacgaataccgcgagctcgcgctatcctccgtgaccacgcacgatcttcctcct
accgcgggacttcttgctggcgagcacatcgagttgcgtaaagagctcggtattcttacc
gtcgatcctgagcaagagcatgaacaagatattcgttggcaaaacgagattctcgacgaa
gtcaagcacaccggtgccttctccggggccacagtgccagaggctttccaagggctcaat
agggaagaacgaggaagcgcagacacccttataccggctatccacaagttcctagccggc
accccctctgctctcacttgtacctcgctggtggatcttgtcggcgaccgccgggcccag
aaccagcccggcacaacctccgatatgtatcccaactggtgcatccccctttgcgatggc
aacatccaagccctgaccatcgaggaaatcgccgatctccccttgttccaagcggtagcg
gacgcgtcaaagcggaacaagcgctag

DBGET integrated database retrieval system