KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1682Help
Entry
Cp3995_1682       CDS       T01689                                 

Gene name
yddQ
Definition
Isochorismatase family protein yddQ
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Cp3995_1682 (yddQ)
Enzymes [BR:cpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Cp3995_1682 (yddQ)
    3.5.1.-  
     Cp3995_1682 (yddQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1796848..1797510
Genome map
AA seq 220 aa AA seqDB search
MSTTLTPFLTPIQRSSMQRVFSYAFCTILVPSQKENMRALIIVDVQNDFCPGGALETVKG
AIQAQSIAEYTASHRGKYDCIAATKDWHIDPGDHFSQTPDFIDSWPVHCIANTEGADFHP
LLSNMHFDEVFYKGHYSAAYSGFEGSTASGELLGEWLKNRGIREIDIAGIATDYCVQATA
LDGLREGFRVTVLSHLCAAVNEDNTHTVLHQLKEHGCVLV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
ttgtccacaacacttaccccctttttaaccccaatacagcgttcttccatgcagcgtgta
ttctcatatgcattttgtactatccttgtgccctctcagaaagaaaatatgcgagccctc
atcattgttgacgtccaaaatgacttttgtccgggaggggcgttagaaacggtcaagggc
gcaatccaagcacaatccattgcagaatacacggcgtctcataggggaaaatacgactgc
atcgcagccaccaaagattggcacattgaccccggcgatcatttttctcagacaccagac
tttattgactcctggcctgtacattgcatagccaacacggaaggcgccgattttcaccca
ttgctctcaaacatgcactttgatgaggttttttataaggggcactatagtgcggcttac
tcggggttcgaggggtccacagcatctggagagttattaggtgaatggttaaagaatcgc
gggatacgcgagattgatatcgcgggaatcgctacggattattgcgttcaggctacggct
cttgacggtttaagagaaggcttccgtgtgacggtgctctcgcacctttgcgccgcagtc
aacgaggacaacacccacacagttttgcatcagcttaaagagcatggatgtgtccttgtt
tag

DBGET integrated database retrieval system