KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_2153Help
Entry
Cp3995_2153       CDS       T01689                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
cpl00260  Glycine, serine and threonine metabolism
cpl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cpl01100  Metabolic pathways
cpl01110  Biosynthesis of secondary metabolites
cpl01130  Biosynthesis of antibiotics
cpl01230  Biosynthesis of amino acids
Module
cpl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cp3995_2153 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cp3995_2153 (trpB)
Enzymes [BR:cpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cp3995_2153 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEX40595
Position
2312071..2313321
Genome map
AA seq 416 aa AA seqDB search
MTLSYNKTTQQTLLPAYFGEFGGQFVPESLLPALDQLEKAFVEAQEDPHFHKELAGYLKD
YLGRPTPLTECSKLPLQGKGKGYARIFLKREDLVHGGAHKTNQVIGQALLAKRMGKKRII
AETGAGQHGTATALACALLNLECVIYMGAKDVERQQPNVYRMELMGATVVSVDSGSGTLK
DAVNEALRDWTATFHESHYLLGTAAGPHPFPTIVREFHRVISEEAKAQMLERTGGLPDVV
VACVGGGSNAIGMFADFIEDASVELVGAEPGGEGLSSGKHGATINNGRIGILHGAKSYLM
RNSDGQVEESYSISAGLDYPGVGPQHAHLSQSGRATYVAITDAEALEAFQLLSREEGIIP
ALESSHALAYALKRAALAEDEGKNITILVSLSGRGDKDIDHIRKTLAANPELSLKD
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgacactttcttacaacaaaaccactcagcaaacactccttcctgcatactttggggag
ttcggcggacagtttgtccccgagtcactccttccagcgcttgatcagcttgaaaaagct
tttgtcgaggcccaagaagacccacactttcacaaagaactagcgggctatctcaaagac
tatttgggaagaccaactccattaacggaatgctccaagctacctttacagggaaaaggt
aaaggatatgcgcgcatcttccttaaacgcgaagaccttgttcacggtggagcacataaa
acaaaccaagttatcggccaggctcttttagctaagaggatgggtaaaaagcgcatcatc
gcagaaactggtgccgggcaacatgggacagcaaccgcccttgcatgcgcacttttaaac
ctcgaatgcgtcatttacatgggagctaaagacgtggaacgtcaacagcccaatgtgtat
cgcatggagcttatgggagctactgtggtgtccgtagattcaggttccgggacactcaaa
gatgcggttaatgaggccctgcgcgattggaccgcaacgttccacgaatcccattatctg
ctcggtacggcagccggacctcatccgtttcccacgatcgtccgagaatttcatcgtgtc
atttcagaggaagctaaagcacagatgcttgagcgcaccggcggactcccggatgttgtg
gttgcttgcgtgggcggaggctccaacgcaataggtatgtttgcagacttcattgaggat
gcatctgtagaactcgttggtgcggaacccggcggtgagggattatcgtccggaaagcac
ggtgcaaccattaacaatggacgtatcggtatcctgcacggtgccaaaagctatttgatg
cgaaattctgatggtcaagtggaagaatcctattccatttccgccgggctggattatccc
ggagtcggtccacagcacgcgcacctatcacagtctgggcgagccacctatgtggccatc
acagatgccgaggcgcttgaagccttccaattactttcccgtgaagagggaatcattcca
gcattagagtccagccacgccctcgcatatgcgttgaaaagagctgccctcgcggaggat
gagggtaagaatatcaccatattggtctccctttcagggcgtggcgataaagacatcgat
cacattcgcaagactctagctgccaaccccgagctttccctcaaggactaa

DBGET integrated database retrieval system