KEGG   Chlamydia pecorum E58: G5S_0061Help
Entry
G5S_0061          CDS       T01466                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00020  Citrate cycle (TCA cycle)
cpm00640  Propanoate metabolism
cpm01100  Metabolic pathways
cpm01110  Biosynthesis of secondary metabolites
cpm01120  Microbial metabolism in diverse environments
cpm01130  Biosynthesis of antibiotics
cpm01200  Carbon metabolism
Module
cpm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    G5S_0061 (sucC)
   00640 Propanoate metabolism
    G5S_0061 (sucC)
   00660 C5-Branched dibasic acid metabolism
    G5S_0061 (sucC)
Enzymes [BR:cpm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     G5S_0061 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AEB41092
Position
complement(57919..59082)
Genome map
AA seq 387 aa AA seqDB search
MHLHEYQAKDLLTSYEVPIPPYRVVFSISEVPQVLQDLGMDSGVVKVQVHAGGRGKHGGV
VVAKSTEEILQAVTKLIGMRFISNQTSGEALPVEKVLISPLVGIAKEYYVAVIMDRKHRC
PTLMLSKSGGMDIEEIAQKFPELLLFLPLTVFGKIYTYQLRQACSFMEWSGDIANQGVKL
IKKLIQCFYDNDASLLEVNPLVLTDADELVALDAKVTLDDNALYRHPHLEACYDPSQENI
RDVLAKQVGLSYIALDGDIGCIVNGAGLAMSTLDILKFYGGAAANFLDVGGSASAQQIKE
AVSLVLSDERVKVLFINIFGGIMDCSLVSSGLVSVMGTRKDTLPIVLRLEGTNVDLGKTI
VQQSGISCHFVSSMQEGAQLSVTLSRT
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttcatgaatatcaggctaaagatcttttaacctcttatgaagtgccaatccct
ccttatcgtgtggttttttcaatttcagaagtcccacaagttttacaagatttagggatg
gattctggtgtagtaaaagtacaagtccatgctggaggaagaggaaaacatggtggcgtc
gtagtcgcaaagtctacggaggaaatcttacaggcagtaactaaactaataggtatgcgc
ttcataagcaaccaaacttccggggaagctcttcctgtagaaaaggttctaatctctcct
ttagtaggaattgctaaagagtattatgttgctgttatcatggatagaaaacatcgctgc
ccgactttaatgctttctaagtctgggggcatggatatcgaagagattgcacagaaattt
ccagagctactcttgtttcttcctttaactgtctttggaaagatttatacgtatcagctc
cgacaggcgtgttcctttatggagtggagcggggatattgcaaaccaaggcgtcaagctt
atcaaaaaacttattcagtgtttttatgataacgacgcttccttattagaggttaaccct
ctagtattaacagatgctgatgagcttgtagccttagatgcgaaagtcactctcgatgat
aatgccctctatcgacatcctcacctagaagcatgctatgatccttctcaggaaaacatc
agagatgttttagcaaagcaagtagggttatcttacattgctcttgatggggatattggc
tgtattgtcaatggcgcagggctagctatgagtacgctagatatcctaaagttttatgga
ggagctgctgcgaattttcttgatgttgggggaagtgcttctgcgcaacaaattaaagaa
gcagtatctttggtgctctctgatgagcgcgtaaaggtgctctttatcaatattttcgga
ggtattatggattgttccctagtctcttcagggcttgtttctgtcatgggaacacggaaa
gatacgcttcctatagtcttgcgcttggagggaacaaatgtcgatttggggaaaactatc
gttcaacagtccgggatctcttgtcattttgtttcgtctatgcaagaaggcgctcagctt
tctgtcactttgagtcgtacgtag

DBGET integrated database retrieval system