KEGG   Chlamydia pecorum E58: G5S_0082Help
Entry
G5S_0082          CDS       T01466                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
cpm  Chlamydia pecorum E58
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:cpm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(84819..85679)
Genome map
AA seq 286 aa AA seqDB search
MRCFKLNQVNHIRAFFSPAKVNLFLKVLHKRPDGFHELCTLMQSIDFGDILTLESSPKDC
LSCNILSLESSENFIWKSLELFRRETGILQPVKWNLKKRIPLKAGLGGGSSNAATALYAL
NFYFQAQLPLKTLQDLAAEIGSDVPFFFSSGTALGYGRGERVASCEGIAENESYVLYFSS
EGVTTEDAYKSLVPSDFSTEHSFNNCKENDLEKAVFRFRKDLLEKKLQLQKLWKPYGGHV
LMSGSGGTLFVRYNATPHREQETSKLIEHTRGIPARKLNKKLTQWY
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
ttgcgatgttttaagctaaatcaggtgaaccacattagggcgtttttctctccagcgaaa
gtaaatctttttttaaaggttttgcataaacgtcctgatgggtttcatgagttgtgtact
ctgatgcagagtatagattttggtgatattcttactttagaaagtagtcctaaggattgt
ctctcatgcaatattttaagtcttgagtcgtcagagaatttcatttggaagagcttagag
ctattcagacgagaaaccggaatcctgcagcctgtcaagtggaacttaaagaaaaggatt
cctttaaaggctggtctcgggggaggaagcagcaacgctgctacagctctatatgcatta
aatttttattttcaggcgcagctacctttaaaaacattgcaagatcttgcagcggagata
ggtagtgatgttccctttttcttttcttctggcacagctctaggatatggacggggagag
agggtagcttcttgtgaaggtattgcggagaatgaaagctatgtattgtatttttcttca
gaaggcgtaactactgaagatgcgtataaatctcttgtcccttcagactttagtacggaa
catagtttcaataactgcaaagaaaatgatttggagaaggcggtatttcggttccgcaaa
gatctcttagagaaaaaattgcagttacaaaaattatggaagccctatggaggacatgtt
cttatgagtggctctggaggcaccctgttcgtccgatataatgcaacacctcatagggaa
caagaaacctctaaacttatagaacatacccgagggatccctgcaaggaagctgaataaa
aaacttacgcagtggtattaa

DBGET integrated database retrieval system