KEGG   Chlamydia pecorum E58: G5S_0112Help
Entry
G5S_0112          CDS       T01466                                 

Definition
Inositol monophosphatase family protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cpm  Chlamydia pecorum E58
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    G5S_0112
Enzymes [BR:cpm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     G5S_0112
Transfer RNA biogenesis [BR:cpm03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    G5S_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115512..116483
Genome map
AA seq 323 aa AA seqDB search
MWSHLPDYQSLAENVVTEIAIHLVHYQQRHSLMTVWEKPDNSFVTPADYGVQYFLKKQLR
QAFPDIPFIGEEVLTLKEDAKKLPEILAFLRNFDPQVTEADLLNTLTPQQLPSSLFWLAD
PIDGTSGFIRKRSFAIALTLIHEGSPILAVMACPSYARNVTIYSAAKGLGLTIYRPGSTE
KLPLNNKKPRAYRYCEASLAASNQQHYTTRLLGLSLPGTPQAFRTESQYKYALVAEGFAD
FFIRYPFVPTQARTWDHAPGAFLVEEAGGIVTDVFGEPLDYGRKDFVLDNHPIILASGSL
EIHETILQVLQRDLHILPTLSSL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtggtctcatttacctgactaccagtctctcgcagaaaatgtggtcacagaaattgct
atccatctcgttcattatcaacaaagacactccctaatgacggtgtgggaaaagcccgac
aactcgtttgttactccagcagattatggcgtacaatatttcctgaaaaaacagctaaga
caagctttccccgacattccttttattggggaggaggtccttacccttaaagaagacgct
aaaaaactccctgaaattctagctttcctacgcaactttgatcctcaagtcacagaagct
gatctacttaacaccctaacccctcagcaacttccctcatccttgttctggctcgcagac
ccaattgatgggacttcaggatttatccgaaaacgttcttttgctatagccctcacctta
attcatgaaggctcccctattttggcagtaatggcctgtccctcctatgcacgcaacgta
actatctattctgcagcaaaaggtcttgggctaactatttatcgccctggaagcacagaa
aagctcccccttaacaataaaaaaccccgagcttatcgttactgcgaagcctcccttgct
gctagcaaccaacaacactacacaacccggttgttagggctaagtctcccaggaactcct
caggccttccgaacagaaagccaatacaaatatgctttagttgcggaagggttcgcagac
ttttttatccgctatccctttgtccctacgcaagcgcgcacttgggatcatgctccgggg
gcattccttgtagaagaagccggcggcatagttacagatgtcttcggcgaacctttagat
tatgggagaaaagactttgtgttagacaaccatccaattatcctagcctctggaagtcta
gaaattcatgaaacgatattacaggtgctacagcgcgacttgcatatcctccctacgctc
tcctctttatga

DBGET integrated database retrieval system