KEGG   Chlamydia pecorum E58: G5S_0121Help
Entry
G5S_0121          CDS       T01466                                 

Definition
(GenBank) conserved hypothetical protein TIGR00423
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AEB41148
Position
122846..123901
Genome map
AA seq 351 aa AA seqDB search
MNSHRLSFKEGLEILVSSPLSELKQLANAIREQRHPNKEVTYVLDANPNYTNICKMNCTF
CAFYRKPHSPDAYLLSLEDFRKLLKYYTTLGIKTVLLQGGVHPTIGIDYLESLVRVTVQE
FPSIHPHFFSAVEIHHAALVSRISEEEALNRLWQAGLRTIPGGGAEILSERVRKLISPKK
MGPGGWLNFHKLSHKVGFRTTATMMFGHVETLEDILIHLESLREAQDECPGFLSFIPWSY
KPQNSPLGKKIPPRHTEEMYYRILAVARIFLDNFDHIAASWFGEGKEVGARALHYGADDF
GGTILDESVHKCAGWELKSTENEIREIIQKAGFIPVERNSFFQRIETISYP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaactcccatcgactatcctttaaagaagggctagaaatactggtttcctctccattg
tcagagcttaaacagttggcaaacgccattcgagaacagcgacatcccaataaagaagtt
acctatgtcctcgatgcgaatccaaattatacaaacatctgtaagatgaattgtacgttc
tgtgccttttatagaaaaccacactctccagatgcttatttactgtctcttgaggatttt
cgtaaattattaaaatattatacaacgctaggaatcaaaacagtcttgttacagggagga
gttcatcctacgattggtatagattatctggagtctttagttcgtgttaccgtacaagaa
ttcccctctatacatccacattttttttctgctgttgaaattcaccatgcagctttagtt
tctcgtatcagtgaagaagaagctctcaataggctttggcaagctgggttaagaactatt
cctgggggtggtgcagaaattctttcagagcgcgttagaaaacttatctctcctaaaaaa
atgggccctggcggatggttaaattttcataagctcagtcataaggtcggctttcggacc
acagcaactatgatgtttggtcatgtagaaacattggaagatatcctgatccatcttgaa
tcactacgtgaagctcaagatgaatgccccggctttctgagctttattccttggagctat
aagcctcaaaactctcctctgggcaaaaaaatccctccaagacatacagaagagatgtat
tatcgtattttggcagtagcacgtatctttttagacaacttcgaccatatagctgcttca
tggtttggagaggggaaggaagttggagctcgagcattacattatggtgctgatgatttt
ggaggcaccattttagatgaaagcgtgcataagtgtgcaggatgggaactaaaaagcact
gaaaacgaaatccgcgagatcatccagaaagcaggctttattcctgtagaaagaaattct
ttctttcagcgcatcgagacaatttcttacccatag

DBGET integrated database retrieval system