KEGG   Chlamydia pecorum E58: G5S_0127Help
Entry
G5S_0127          CDS       T01466                                 

Gene name
murC
Definition
(GenBank) MurC/ddl bifunctional enzyme
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
cpm  Chlamydia pecorum E58
Pathway
cpm00471  D-Glutamine and D-glutamate metabolism
cpm00550  Peptidoglycan biosynthesis
cpm01100  Metabolic pathways
cpm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    G5S_0127 (murC)
   00473 D-Alanine metabolism
    G5S_0127 (murC)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G5S_0127 (murC)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    G5S_0127 (murC)
Enzymes [BR:cpm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     G5S_0127 (murC)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     G5S_0127 (murC)
Peptidoglycan biosynthesis and degradation proteins [BR:cpm01011]
 Precursor biosynthesis
  Amino acid ligase
   G5S_0127 (murC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Mur_ligase Dala_Dala_lig_N Mur_ligase_M Mur_ligase_C ATP-grasp CPSase_L_D2 ATPgrasp_YheCD ATP-grasp_4 ATP-grasp_3 RimK Synapsin_C
Motif
Other DBs
NCBI-ProteinID: AEB41154
Position
complement(126993..129419)
Genome map
AA seq 808 aa AA seqDB search
MRTTPHYHFIGIGGIGMSALAHILLDKGFSVSGSDSSQNSIINKLKTKGALCFYGHHEDH
IPEHATVIYSSGISEDNVEFCKAKQRGLPLLHRSQCLAMLMEESTKILISGSHGKTTTTS
LIIAIFQEAKNDPSYAVGGLNSESLNGHAGSSSIFIAEADESDGSLKHYAPDVAVVTNLD
EEHLVNYDDDPEKLLKAMQEFSNKVRDSQKVFYNGDCPQLKGEISGITYGFSPSCQLQVV
SFYQREWQSSFSFIFCGIEYQNIELNLPGRHNVLNAAAACGVALTFGIEISVIRKALKKF
PGVQRRLEQKNCSNKYLYLEDYAHHPVEISHTLQAVRDAVGLRRVIAIFQPHRFSRLQAC
LDLFPHAFKDADEVILTDVYSAGEPFVEISMEQLSNQIALKSLVKCSYIPFDQLVQFLKE
KIRVHDVCISLGAGNIHVLGSALKNFEPRKLSIGLVCGGKSCEHEISLLSARHVSHRFSQ
EYYDCTFFVISRDGLWNVVQDLNTPLPKEQGSPVLSSEIAKALLSIDFFLPILHGPFGED
GSIQGFFEILGKPYGGPDLLPAAISMDKLMTKRVASAVGVPVVPYQELSLFAWKRNPEGC
IRSILDIFTFPMVVKSSHLGSSLGIFLVNNKEELEEKISEAFLYDTDIFIEESRLESREI
EISCIGQPYSFYIAKPNERRGSQGFIGYHEKYGLNGISSARIIFDLQLPKESENRVKEFA
ERVFKAIQGKGCARIDFFLDEEGNYWLSEINPIPGMTASSSFLRAFEQSEWSAEKVLDYL
IIEGLHRFDKQEKVLRVPHPTCDYAKKS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaacgcctcactatcattttattgggataggcggtattggaatgagtgcatta
gcacacatcttgctggacaagggattttcagtgtccgggagtgattcttcgcaaaattcc
atcataaataagctaaaaactaagggagctttgtgtttttatggccatcatgaagaccat
attcctgagcatgcaactgtgatttatagctcggggatctccgaggataacgtagaattt
tgtaaagcaaaacagcgagggcttcctctgcttcatcgctcgcagtgcttagcaatgctt
atggaagaaagcacaaaaattcttatatcaggaagtcatgggaaaactacaacgacttct
ttgatcatcgcaatttttcaagaagcaaaaaacgacccctcttatgctgttggaggccta
aattcggaatctctgaatggccatgcagggagctcctcgatatttattgcagaagccgat
gagagtgacggctccttaaagcactatgctcccgacgttgccgtcgtgacaaacttagat
gaggagcatcttgttaattacgatgatgaccctgaaaagctcttaaaggcaatgcaggag
ttctcaaataaagtcagagattcccaaaaggtattttataatggagattgcccccagcta
aaaggggagatctcaggaattacctatgggttttctccatcctgtcaactgcaggtcgta
tctttctatcaaagggaatggcagagctcattttcctttatcttttgtggtatagaatat
caaaatatcgagctcaatctccctggccggcataacgtcctgaatgctgctgcagcctgt
ggggtggcattgacttttgggattgagatttctgtgattcgtaaggctttgaagaagttc
ccaggagtgcaacggaggttagaacagaaaaattgctctaataagtatctttaccttgaa
gattatgcccatcatcctgtggagatttcccataccttacaagctgtccgtgatgctgta
gggttgcggagggtcattgcaattttccagccacataggttttcacgactgcaagcctgt
ttagatctgtttcctcatgcgtttaaagatgctgacgaagtgattttaacagatgtctat
agtgctggagaaccctttgtagagatctccatggaacagcttagcaaccaaattgctttg
aagtctcttgtgaagtgctcttatattccttttgatcagcttgtgcagtttttgaaagag
aaaattcgtgttcatgatgtttgtatttccctaggggcaggaaatattcatgttttagga
agtgccctaaagaactttgaacctagaaagttatctatagggcttgtatgtggggggaaa
tcatgtgagcatgaaatctctctactttctgctcgccatgtttcccataggttttctcag
gagtactatgactgtacattttttgtcatcagccgcgatggattatggaacgttgttcag
gatttgaataccccccttcctaaggagcagggaagccctgtattatcttcagaaattgcc
aaagccttgctaagtatcgactttttcttaccgatattgcatggcccctttggggaagat
ggctctatacagggattttttgaaattttagggaagccttacggaggaccagatttgctt
cctgctgcgatctctatggataaactcatgacaaaacgcgttgcgtctgctgtaggggtt
cctgtagtcccctaccaagagctctcgttgtttgcttggaaaagaaatcctgaaggttgt
atccgcagcatattggatatcttcacgttccctatggttgtgaaatcttcgcatcttgga
tctagcttggggattttccttgtaaacaataaagaggagcttgaagagaaaatttcagag
gcttttctttatgatacagatatttttattgaagagagccgcttagagtctcgggaaatc
gaaatttcttgtataggccagccttatagcttttatattgcaaaacctaatgaaaggcgt
ggttctcagggatttattgggtaccatgagaaatatggcctgaatggaatatccagtgct
aggattatctttgatttgcagcttcctaaagaatcagagaatcgtgtaaaagagttcgca
gaacgcgtatttaaagcgatccaaggtaaaggttgcgctaggatagatttctttttggat
gaagaaggaaactattggctttcagaaatcaatccaatcccgggaatgacagcgtcgagt
tcttttttaagagcttttgaacaatccgaatggtctgcagaaaaagttctagattatctc
attatagaaggtttacatagattcgacaaacaagagaaagttttgagagttccgcatcct
acgtgtgattacgcaaaaaaaagctaa

DBGET integrated database retrieval system