KEGG   Chlamydia pecorum E58: G5S_0130Help
Entry
G5S_0130          CDS       T01466                                 

Definition
(GenBank) muramidase
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(131568..132236)
Genome map
AA seq 222 aa AA seqDB search
MVITAVLMNAILLVALFATSKRGVVKNYAENYSEFSSEKIVKVLAPEEKLPEASQVAAVV
PAQPVPVAKEVLAAQFMEEQHIVVSPQQPAQEAQEVQQQPQPVVEERKEAFTTVIVKKGD
FLERIAKANHTTVSTLMQLNDLSSTQLKIGQVLKVPVVEQVATQSSRPETLNPENYYTVQ
EGDSPWTIALRNHIRLEELLRLNNLDEHKARRIRPGDQLRIR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtaatcactgctgttttgatgaatgcaattttgcttgtggctttgttcgccacgtca
aagcgtggtgtagtaaaaaattatgcagagaattattcagagttttcctctgaaaagatt
gtcaaagttcttgcccctgaagagaaactcccagaggcttctcaagtggctgctgtcgtt
cctgcacagccagttcccgtagctaaagaggtcttggcagcgcagtttatggaagagcaa
catattgtggtttctcctcaacagcctgcccaggaagctcaagaagtgcagcagcaaccc
cagcctgttgtggaggaacggaaggaggccttcactacagtgattgtaaagaaaggggat
ttcctagagcgtatagcgaaagccaaccatacgacagtgtctactctgatgcagttgaat
gatttgtcttcaacacaattaaaaattggtcaggtattaaaagtccctgttgtggagcag
gttgctactcaaagttcccgccccgaaacattgaatcctgaaaattactatactgtgcaa
gaaggggatagcccttggactattgctttaaggaatcatattcgtttagaggaactactt
cgactcaataatcttgatgagcataaggcaagacggattcgtcctggggatcaactgcgt
atacgatag

DBGET integrated database retrieval system