KEGG   Chlamydia pecorum E58: G5S_0132Help
Entry
G5S_0132          CDS       T01466                                 

Gene name
mraY
Definition
(GenBank) muramoyl-pentapeptide transferase
  KO
K01000  
phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
cpm  Chlamydia pecorum E58
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G5S_0132 (mraY)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    G5S_0132 (mraY)
Enzymes [BR:cpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     G5S_0132 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:cpm01011]
 Precursor biosynthesis
  Glycosyltransferase
   G5S_0132 (mraY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(133508..134449)
Genome map
AA seq 313 aa AA seqDB search
MQSSNFLDQIAKEHCGKLEALHKDKAHVPTGGGILLFLVFLMALIVWMPWFRLITWIMLV
LACCWCGLGWYDDAIKNKKKKGHGLKAKHKFFIQVCIAIATLAVLPKVYGSTQPLFTLQI
PFYSNYVQFHSFLGKIFCLGLAVVAIVGTCNAVNITDGLDGLAAGSFCFASLGLLLVALY
RPMAPEITLEVLIVLATLIGMGAGFLWYNSFPAQVFMGDTGSLLLGGLLGCCAVIMRAEI
FLVIFGGVFVVEAGSVILQVLSCKLRKKRIFLCSPLHHHFEYKGVPEPKIVQRFWLFGVF
CVFVGVVALFWGY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ttgcagagctctaactttttagatcaaattgctaaggagcattgtggaaaacttgaagct
ctccataaagacaaagctcatgttcctactggaggaggcatccttttatttctcgtattt
ttgatggccctgatagtttggatgccgtggtttagactaataacatggatcatgcttgtc
ctggcatgctgttggtgcgggttgggatggtacgatgatgcgatcaaaaataagaagaaa
aagggacatgggttaaaggcaaaacataagttttttattcaggtgtgcattgcgattgca
acgttggcagtattgccgaaagtttatggtagcacacaacctttatttaccttgcaaatt
cccttttactctaattatgtgcagtttcattcgttcttaggaaagattttttgtttggga
ttagcagtcgtcgcaattgttgggacgtgtaatgcagtaaatattacagatggtttagat
ggcctggccgcagggagcttctgttttgcctccttaggccttcttcttgttgcgttatat
cggcccatggctccagaaatcaccttggaggtcttaattgttttggcaaccctaataggt
atgggagcgggatttctatggtataatagcttcccagctcaggtatttatgggggatacg
ggatctttattgttaggtgggttgttaggatgttgcgcggtaatcatgagggcggaaata
tttttggtgatttttggcggagtttttgttgtcgaggcgggatccgtcattttacaggtg
ctcagttgtaaactccgaaaaaagcggatatttttatgttctccattgcatcatcatttc
gaatataaaggtgttcctgaacctaagattgtacaacgcttttggctgtttggggtcttt
tgtgtttttgttggggttgtggctttattttggggatattaa

DBGET integrated database retrieval system