KEGG   Chlamydia pecorum E58: G5S_0135Help
Entry
G5S_0135          CDS       T01466                                 

Definition
(GenBank) heat shock protein-60
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
136223..137725
Genome map
AA seq 500 aa AA seqDB search
MSDQGKLSNCEVDKKLFLGIKKVYDVAKKFYGPRLIPSSLTFLEERGYSVLSHMTLEDPH
ENAGADFAKAMANAIHKKHLDGATTGLILLYSILKESYVFINQGLSTYKLSLALQKKSSQ
LLEHLHTYSWPVKDPKKIKDLVLTALRYPSIAENISSAVAAIGPSGCISTTRSYQIDLQV
TQGIKIDFGYTSTYFISDPLSRTTTLSFPYILILDQKISSIHRILLLLKEISQNHKHLLI
FCEDIDKDVLATLIVNKLRKLLQVTVVTIPELSTKRQNLAKDLALFTGTHVYSQDADLSM
TMLGSCASAEISETQTLLIYGQHVPEVLALKIRQLDEEIRTTTSPEEKLALLERKQRLQG
SLVLITTKEETEPLYTLGLRLANSAKEHGYLPGGGVSLLYASLSLDKDSLSTEELAATHI
LQTACRAPLEQLILNSQADCDVVINKLKSLATASMGFNVLSQEIEDLIAGGVLDSLATIS
TALSCATETAITVFSSKVIT
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcaggggaagctatcaaactgcgaagtagataaaaagctttttttagggata
aaaaaggtctacgacgttgctaaaaagttttatgggccccgcctgattccgtcttcttta
acatttttggaggagcgcggctactctgtcctttctcatatgactcttgaagatccccat
gaaaatgctggagcagattttgctaaggccatggcgaatgctatccataaaaagcattta
gacggtgctactacggggctcattcttctctactccatattaaaagaaagctacgttttc
attaatcaaggtctctcgacttataaactctccttagcactgcagaagaaatcctcccaa
ctccttgagcatttacatacgtattcctggccagtgaaagatcccaagaaaatcaaagat
ttggtgttaacagcactgcgttatccttccattgctgagaatatctcctctgctgttgct
gcaataggaccttcaggatgtatttctacaacgagaagttatcaaatagacctccaggta
acccaggggataaaaatagattttggctatacatcgacatattttatttccgatcccctt
tcacgcacaactacgctctctttcccttatattctcatcctagatcagaaaatttccagc
attcataggatccttcttctgcttaaggaaatctctcaaaatcacaaacatcttttgatt
ttctgcgaagacattgacaaagatgttcttgcaacgctaatcgtgaacaagcttcggaag
ttattacaggttactgttgtaactatccctgagctctcaacaaagcggcagaacttagca
aaagatctagctctatttacagggacacacgtttactcgcaggatgctgatctgagcatg
accatgctaggctcctgcgcctctgctgaaatctctgaaactcaaacactactaatttat
ggccaacatgttcccgaagttcttgcgttgaaaattcgtcaactcgatgaggaaatccgc
acgacgacctcacctgaagaaaaattggctcttctggaaagaaaacaacgcctgcaaggt
tctttagttctaattactactaaggaagagacagagcctctatatacattaggtcttaga
ctagccaattccgcaaaagagcatggctatctccccggaggtggggtctctttactgtat
gcttctttaagcttagataaagacagtctttctacagaagagctcgcggcaacacatatt
ttacaaaccgcgtgtagggcgcccttagagcaactgatcctcaattcacaggcagattgt
gatgtagtgattaataaactaaaatctcttgcaacggcaagtatgggttttaacgttctc
tctcaggagattgaagatctcattgcaggaggtgttttggattctttggcgaccatttcc
acagctttatcttgcgccacagaaactgccattactgtgttctcttcaaaagtgatcact
tag

DBGET integrated database retrieval system