KEGG   Chlamydia pecorum E58: G5S_0145Help
Entry
G5S_0145          CDS       T01466                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
149622..151016
Genome map
AA seq 464 aa AA seqDB search
MSNTLSPMFNIDFKFLEGLHQPAPRYTSYPTALEWEPSDEAPARVALQRIKNSPQPLSLY
FHIPFCQSMCLYCGCTVILNRREEIVEDYINTLLQEISLISQELGMKFPVSRIHFGGGTP
SRLSRYMFEKLFHQLHKCFDLSQTEEIAIEIDPRSLRNDMEKAEFFQNLGFNRVSLGVQD
TQAAVQEAVKRRQTHEESRRVYEKFKELGFTSINIDLIYGLPKQTRHTFAQTIQDILAMR
PDRLALFSYAAVPWIKPHQKAIKATDLPSMEEKFAIYSQSRHSLIKAGYQAIGMDHFSLP
EDPLTVAFHNKTLIRNFQGYSLPPEEDLIGLGISATSFIRGIYLQNTKALDIYQEKILSH
SLATEKSKELSKDDLIRKWVIHKLMCTFVIEKEEFFSLFGHSFDEYFSDSQERLLSMERT
GLIQNSSSFLTVTPLGELFVRVIATAFDHYFLKKVSSPRFSASI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacacgttatcgcctatgttcaacatcgattttaaattcctagaaggacttcat
caacccgcaccaagatatacaagctaccctacagctttagaatgggagccttctgatgaa
gcccctgcacgcgttgctctgcaaagaataaaaaattctccccaacctttgtctttgtat
ttccacattcccttttgccaatcgatgtgtctgtattgtggatgtactgtgattctcaac
cgcagagaagagattgttgaggactacatcaatacgctcctccaagaaatctctcttatc
tcgcaggaattaggaatgaagttccccgtttctcgaatccattttggaggaggcactcct
agccgtctttctcggtatatgttcgagaagctctttcatcaactccacaaatgctttgat
ctctcccaaacagaagagatcgcgatagagatagacccacgttctttaaggaacgatatg
gagaaggcggagtttttccaaaatcttgggtttaatcgtgtaagcttgggagtacaagat
acccaagctgccgtacaagaagccgtaaagcgacggcagacccatgaggagtcacgacgt
gtgtatgagaagtttaaagagctgggctttactagcatcaacattgatctaatctacggc
ttgccaaagcaaacccgtcacacctttgcgcaaactatccaagacatcctcgcaatgcgc
ccggatcgtctggcattattttcttatgctgcagtcccttggatcaaaccgcaccaaaaa
gcaatcaaagctacagatcttccctctatggaagaaaaatttgcgatatactcacaatcc
cgacatagcttaatcaaggcaggctaccaagctattgggatggatcatttttctcttccc
gaagatcccttaacagtagcgtttcataacaaaacattaattcgtaattttcaagggtat
tccctgcctcccgaagaagaccttatcggactaggaatctctgcaacaagttttattcgt
ggaatatacctgcaaaatacgaaagctctcgatatctatcaggagaagatcctttcacat
tctctagcgacagaaaaaagcaaagagctctccaaggatgacctgattcgaaaatgggtc
atccataagcttatgtgtacctttgttatagaaaaagaagagtttttctctctttttggt
catagctttgatgaatatttttctgatagccaagagaggcttctaagtatggaacggaca
gggttaatccaaaatagctcgtcatttcttactgtcactcccttaggggagcttttcgtt
agggtgatcgctaccgcatttgaccactatttcttaaagaaagtatcttcaccgcgattt
tcagcatcaatatga

DBGET integrated database retrieval system