KEGG   Chlamydia pecorum E58: G5S_0148Help
Entry
G5S_0148          CDS       T01466                                 

Definition
(GenBank) Histone H1-like protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
155101..155457
Genome map
AA seq 118 aa AA seqDB search
MALKDTAKIMKDLLESIQHDLMKADKGNKAAAQRVRTDSIKLEKIAKVYRKESIKAEKSG
LMKRKPAAKPVRAKKAAPKKACKAAAAKVKKAPPKKVANKSVRVPAKVKKVSKSRSRK
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggcgctaaaagatacggcaaaaattatgaaagacttgttggaaagtatccaacatgac
ttaatgaaagcagacaaaggaaacaaagccgcagcacaaagagttcgcacagactccata
aagctagaaaaaattgctaaagtctatcgcaaagaatctatcaaagcggaaaaatctggc
ctgatgaaacgcaaacctgcagcaaagccagtaagagcaaaaaaagctgctcctaaaaaa
gcatgtaaagctgcagcagcaaaagtgaaaaaagctccccctaaaaaagtagctaataaa
agtgtcagagtcccagcgaaagtaaaaaaagtttctaagtcccgctctagaaaatag

DBGET integrated database retrieval system