KEGG   Chlamydia pecorum E58: G5S_0150Help
Entry
G5S_0150          CDS       T01466                                 

Definition
(GenBank) tRNA (Uracil-5-)-methyltransferase
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_U5-meth_tr Met_10 Cons_hypoth95 PrmA MTS Methyltransf_31 Methyltransf_15 Methyltransf_25 PCMT NodS Methyltransf_18
Motif
Other DBs
NCBI-ProteinID: AEB41175
Position
155615..156805
Genome map
AA seq 396 aa AA seqDB search
MKDCRHLSFCGGCSSPQTAYSTFLKAKELLLQELFSSLISEIRPVIPCTPILRGRNKMEF
SFFQSRDQQKSLGLMSSSKPRQGIQITECLLTQEDTMEILRLTRLWWERHVYLTAYFPPK
NRGCLCTLTIRYGYPKKEIMVILTTSGAPEYTISPEALEDWKQTLLGSSLNISSIFWEEK
HSTPGLPTQYLQTLLYGEPYIQQTLTLPSDGSSATFNIRPKSFFQPQTLQAARIIDTVKE
FINPQGTEILLDLYCGVGTLGIMLAPYVQKVIGVENVPEAILSARENILINHQENRMEVF
LEDTKTFCKKLPYTCPPDIIIVDPPRCGLQNKALKHILKIGAPKLVYISCNPRTQFQECF
QLIHAGYSIKAMQPIDQFPHSPHLENILLLERSSFL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaagactgccgtcatctctctttttgtggaggatgttcttctccccaaacagcctat
tctacctttttaaaagctaaagaactcctccttcaagagttattctcctctctcatttca
gaaatccgacctgtcattccctgcactccaatattgcgaggaagaaacaaaatggagttc
tcctttttccaatcgagagatcagcaaaagagcttagggttgatgagctcctcaaaaccc
cggcaaggaatccaaattacagagtgcctgctcacccaagaagataccatggaaatcctc
cgactcacaaggctatggtgggaaaggcacgtctaccttaccgcatatttccctcccaaa
aatcgcggctgcttgtgtactttaacaatacgctatggctatcctaaaaaagaaatcatg
gtaatcctaaccacatcaggagcccctgaatataccataagccctgaggcattagaagac
tggaaacaaacattgctaggttcttctctcaatatttcctctattttctgggaagaaaaa
cactcaaccccagggcttcccacacagtaccttcaaaccttactttatggggaaccttac
attcaacagactcttactctccctagcgatggcagctctgcaacctttaacattcgccct
aaaagcttcttccaacctcaaacccttcaagctgcacgaattatcgatacggtaaaagaa
ttcataaaccctcaaggaaccgaaatccttttagatctgtattgtggtgtagggactcta
ggcattatgctcgctccatatgtccagaaggtaattggcgtagaaaatgtccctgaggcg
atactttctgcaagagaaaatatccttatcaaccatcaagaaaatcgcatggaggtgttt
ctagaagataccaaaacattttgtaaaaagcttccatacacctgcccccctgatattatc
attgtagaccctccccgctgtgggctacaaaacaaagcgctaaaacatattttaaagatt
ggtgcgccaaagcttgtgtatatttcctgcaatccccgcacgcagtttcaggaatgtttt
caacttattcacgcaggctatagcataaaagctatgcaacctatagatcagttcccacat
tcccctcatttagaaaatattcttttattagaaagatcctctttcctctag

DBGET integrated database retrieval system