KEGG   Chlamydia pecorum E58: G5S_0151Help
Entry
G5S_0151          CDS       T01466                                 

Definition
(GenBank) preprotein translocase, YajC subunit
  KO
K03210  
preprotein translocase subunit YajC
Organism
cpm  Chlamydia pecorum E58
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    G5S_0151
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    G5S_0151
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    G5S_0151
Secretion system [BR:cpm02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   G5S_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
156875..157225
Genome map
AA seq 116 aa AA seqDB search
MRSYITCFLFLLASLQVFAEDDMAQAKNTFLQPAVMLAIAILFFYFILWRPEQKRRKAAE
KRKNELAKGDKVTAMGIIGVIDEVREHTVVLNIASGKIEILKAAISEILKPDGTRA
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcggtcttacattacatgttttttatttttgctggcgtctttacaagttttcgctgaa
gatgacatggcccaagctaaaaatacctttttacagccagctgtgatgcttgccattgcg
attttatttttctattttattctatggcgtccagagcaaaagcgcagaaaagctgcagaa
aaacgtaaaaatgaactcgctaaaggggacaaagttaccgcaatggggattattggcgtt
attgatgaagttcgtgagcacacagtcgtgttgaacattgcttctggaaaaattgaaatc
ctcaaagcagcaatttctgaaatcctgaaaccagacgggacaagagcttaa

DBGET integrated database retrieval system