KEGG   Chlamydia pecorum E58: G5S_0166Help
Entry
G5S_0166          CDS       T01466                                 

Definition
(GenBank) lipoprotein, putative
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4995 Atx10homo_assoc
Motif
Other DBs
NCBI-ProteinID: AEB41184
Position
complement(170259..170918)
Genome map
AA seq 219 aa AA seqDB search
MKKSLYNVLLGSILLMTGLTSCCLNPFKARKNLKNSKDLNQKSVKLVEARDLQPAQKRPR
RLRRLFSRRGLPKKDEQEVTANFKAYSDYVSEHDKRDISFVVNAVAEKSSLSLALSQGEI
KDALSRIREIHPLALMQVLAENPELIEGVKKMQGRDWVWTMFINQLSQVFSQAVRQNVIS
EEDIASFSSTLKLDSGTVASVVYGERWPELVDLVVSQPS
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcattatataatgtgcttctgggaagcatacttctcatgacaggcttgaca
agttgttgtttgaatccttttaaggcacgcaaaaatttaaaaaattctaaagacttaaat
cagaagtctgttaaactggtggaagcgcgggatcttcaacctgctcaaaagcgcccccgt
cgtttgcggaggcttttttctcggcgtggcctgcctaaaaaggatgaacaagaagtgaca
gcaaatttcaaagcatactcagactatgtttcggagcacgataaaagagatatctctttt
gttgtgaatgctgttgctgaaaagtcttcgctgtcgttggccctctctcaaggtgagatc
aaagatgctttgagtcgcattcgtgagatacaccccttggctttaatgcaagttcttgct
gaaaatcctgaattaattgaaggtgtgaagaaaatgcagggccgtgattgggtttggacg
atgtttataaatcaattgagccaagttttttcccaagcagtacgtcagaatgtaatttct
gaggaagacattgcctccttttcttctactttaaaattagactctgggaccgttgcttcc
gttgtatacggggaaaggtggccagagcttgtggacttagtggtttcgcagccttcataa

DBGET integrated database retrieval system