KEGG   Chlamydia pecorum E58: G5S_0167Help
Entry
G5S_0167          CDS       T01466                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cpm  Chlamydia pecorum E58
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LIF_OSM
Motif
Other DBs
NCBI-ProteinID: AEB41185
Position
171167..172534
Genome map
AA seq 455 aa AA seqDB search
MGAQYFIKGFAFLSVLSIALPSFAMPSQTSVRYKNKTTQSGKIKVGSELWIEQKLRQFPE
LLWLTEPSTLSLKTPLSVGTSYSLALFNKKVPAFDITMRSLIYLHLLMQGSRQAYAQLAQ
MTSSEEAMTFKQYQSLHKQLSGFLNSSKGFDNPLKILETAIVLRLLGCSTKAVATFKPYF
SDSCTETFYTKSLHVLKTLPELCPSFARLTPEQQEIFRSLRHFGNYESLFNLTEAPSPQL
LSAGRSHRPLVVLDLYLYCFDASGHGKGSQDFYYSFSLLLSMLQEHATVEEAFSRYLIYR
ANRLGFEGNSRGEMTLVRLATLMNLPPAEASALSWSFKNLSSEEASTLVNHFYTLQGEHI
PLSIHGLPSLISGLFDANRSTTTNPENRLQQVYSTFLSLLVKSLREQKEMLHKQLISPDT
ILDFSETTNSCKGLDVFSENISVRVHFSGEVSVIM
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcacaatattttattaaaggttttgcctttctttctgttctttctatagcactc
ccttcttttgctatgccatcgcaaacttctgttagatataaaaataaaaccacacaatct
ggaaagattaaagtcggttctgaactatggatagagcaaaagctacgtcaatttcccgag
ttattatggcttacagaaccttctactctctctttaaaaactccgctttctgtagggaca
agttattccttagcgttatttaataaaaaggttcctgcgtttgatattacgatgcggagt
ttaatttacctgcatttgcttatgcaggggtcacgtcaagcctacgcgcagttagctcag
atgacttcttccgaagaagcgatgacatttaaacaatatcagtccctacataaacaactc
tcgggatttttaaattcctcaaaagggtttgacaaccccttaaaaattctagaaacggca
attgtattgcgtcttttagggtgttctacaaaagctgttgccacatttaagccttatttt
tccgattcttgtactgaaaccttttatacaaaatctctacatgtcttgaagaccctcccg
gagctctgtccctcatttgctcgacttacgcctgagcaacaagaaatatttcgctctttg
agacattttggaaactacgagtctttattcaacctcacagaagctccttctcctcagcta
ctctccgcggggaggtctcatcgtcctttagttgtgctagatttgtatttgtattgcttt
gatgcgagcggccatgggaaagggtctcaagatttctactatagcttttctctcttgctt
tcaatgttgcaagagcatgccactgtagaagaagcattttctcggtatcttatctatcgt
gcgaatcgtttgggctttgagggaaattcccgaggggagatgaccttggtacgcttagcg
acattgatgaacctccccccagcggaagcatcagctttaagttggagcttcaaaaatctc
tcttctgaagaggctagtactcttgtgaaccatttctatactcttcagggagagcatatc
cctttatcaattcatggcttgccaagtttaatttcgggattatttgatgcgaaccgcagt
acaacgacaaatcctgaaaatcgtttgcagcaggtatactctacatttctttctctatta
gtaaaaagcttacgagaacaaaaagaaatgcttcataagcaacttatttctcctgacact
atcttagacttttcagaaactacaaactcctgcaaaggcctggatgtattttctgaaaat
atttctgtacgcgtgcattttagtggagaggttagcgttatcatgtaa

DBGET integrated database retrieval system