KEGG   Chlamydia pecorum E58: G5S_0170Help
Entry
G5S_0170          CDS       T01466                                 

Gene name
ribD
Definition
(GenBank) riboflavin biosynthesis protein RibD
  KO
K11752  
diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC:3.5.4.26 1.1.1.193]
Organism
cpm  Chlamydia pecorum E58
Pathway
Riboflavin metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Quorum sensing
Brite
KEGG Orthology (KO) [BR:cpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    G5S_0170 (ribD)
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    G5S_0170 (ribD)
Enzymes [BR:cpm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.193  5-amino-6-(5-phosphoribosylamino)uracil reductase
     G5S_0170 (ribD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.26  diaminohydroxyphosphoribosylaminopyrimidine deaminase
     G5S_0170 (ribD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(174378..175496)
Genome map
AA seq 372 aa AA seqDB search
MEDFSEQQQLFMRRAIEIGERGRITTPPNPWVGCVLVKNGKILSEGYHEYPGGPHAEEIA
IRKAHVSLEGAQVYLSLEPCSHYGKQPPCTDLLIKHRVAEVFIALKDPDCRVSGKGIESL
KNVGIRVHVGLEEARARKSLQPYLYQRSSCSPWVVLKSAASIDGQVADRNSQSQWITCPE
ARHDVGFIRACSQAVIVGAGTVIADNPKLTARRASGELYARQPLRIVLDSSGRVPKESQV
FHLGGEVLYVTTKRCPSQHLQYLEALGVEIACVKASSSGVDLHEVMRLLANKHFLQVLVE
GGATVHTEFLKHHLANAIILYYGPKILGDQKKPLFKELGDCLHTAQAVLPLSADFVGNSL
KVFWEIPLKKQG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaagatttttccgagcaacaacaactttttatgcgtcgtgctatagaaattggagag
cgcggaagaatcaccacccctcccaacccttgggtgggatgtgttcttgttaagaatgga
aaaattttgagcgagggatatcatgaatatcctggagggccccatgcagaagaaatcgca
atccgtaaagcacatgtgagtttagaaggagcccaggtatacctttccttagagccttgc
tctcactatgggaaacagcctccctgtacggatctccttataaaacatcgtgttgctgaa
gtgttcattgctttgaaagatcccgactgtcgcgtttctgggaaaggtattgaaagctta
aaaaacgtaggaattcgcgtacatgttgggctagaagaagctcgcgcaagaaaatctttg
cagccctatctctatcaaaggagttcttgctccccctgggtcgtgttgaaaagtgccgca
agtatagatggacaggtagcagatagaaattcccaatcacaatggatcacctgcccagaa
gctcgtcatgatgtaggatttattcgtgcctgttctcaagcggttattgtaggagcaggg
actgtaattgcagataaccctaaacttactgctcgtcgtgcttcaggagagctctatgca
agacagcctctccgtatagttttagatagctcaggaagagtccctaaggagtctcaggta
tttcatctcggtggggaagttctttatgtgactacaaagcgctgtccttcgcaacacctc
caatatttagaagctttaggtgtagagattgcttgtgtaaaagcttcctcctctggagta
gaccttcacgaagtcatgcgtttgctggcgaataaacatttccttcaagttctcgtagaa
ggaggcgcaactgtgcatacggaatttttaaaacaccatctggccaacgctatcatttta
tattatggcccgaaaatccttggagatcagaagaaaccactgtttaaagagctgggggat
tgcctacatacggcccaagctgttctcccattaagtgctgattttgtagggaattcttta
aaagttttttgggagattcctcttaagaagcaaggatag

DBGET integrated database retrieval system